HAUS3 (HAUS augmin like complex subunit 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79441
• Gene name: HAUS augmin like complex subunit 3
• Gene symbol: HAUS3
• Synonyms (NCBI Gene): C4orf15, IT1, dgt3
• Chromosome: 4
• Chromosome location: 4p16.3
• Summary: This gene encodes a component of the HAUS augmin-like protein complex, which plays a key role in cytokinesis and mitosis. Disruption of the encoded protein causes mitotic defects resulting from fragmentation of centrosomes and microtubule destabilization.

miRNA Show/Hide all (709)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016206	hsa-miR-590-3p	Sequencing	20371350
MIRT024331	hsa-miR-215-5p	Microarray	19074876
MIRT026668	hsa-miR-192-5p	Microarray	19074876
MIRT027195	hsa-miR-103a-3p	Sequencing	20371350
MIRT031858	hsa-miR-16-5p	Sequencing	20371350
MIRT532311	hsa-miR-548c-3p	HITS-CLIP	19536157
MIRT532310	hsa-miR-1911-3p	HITS-CLIP	19536157
MIRT532309	hsa-miR-3613-3p	HITS-CLIP	19536157
MIRT724781	hsa-miR-4645-5p	HITS-CLIP	19536157
MIRT724780	hsa-miR-4673	HITS-CLIP	19536157
MIRT724779	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT016206	hsa-miR-590-3p	HITS-CLIP	21572407
MIRT504856	hsa-miR-7849-3p	HITS-CLIP	21572407
MIRT504855	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT504854	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT031858	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT504853	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT504852	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT504851	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT504850	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT504849	hsa-miR-4666a-3p	HITS-CLIP	21572407
MIRT504848	hsa-miR-922	HITS-CLIP	21572407
MIRT504847	hsa-miR-4645-3p	HITS-CLIP	21572407
MIRT504846	hsa-miR-4468	HITS-CLIP	21572407
MIRT504845	hsa-miR-514a-3p	HITS-CLIP	21572407
MIRT504844	hsa-miR-514b-3p	HITS-CLIP	21572407
MIRT668029	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT668028	hsa-miR-5586-3p	HITS-CLIP	23824327
MIRT668027	hsa-miR-5694	HITS-CLIP	23824327
MIRT668026	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT668025	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT668024	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT668023	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT668022	hsa-miR-1285-3p	HITS-CLIP	23824327
MIRT668021	hsa-miR-3187-5p	HITS-CLIP	23824327
MIRT668020	hsa-miR-5189-5p	HITS-CLIP	23824327
MIRT668019	hsa-miR-612	HITS-CLIP	23824327
MIRT668018	hsa-miR-6860	HITS-CLIP	23824327
MIRT668017	hsa-miR-4252	HITS-CLIP	23824327
MIRT668016	hsa-miR-661	HITS-CLIP	23824327
MIRT668015	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT668014	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT668013	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT668012	hsa-miR-7703	HITS-CLIP	23824327
MIRT504855	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT504854	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031858	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT504853	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT504852	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT504851	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT504850	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT504848	hsa-miR-922	PAR-CLIP	20371350
MIRT504847	hsa-miR-4645-3p	PAR-CLIP	20371350
MIRT504846	hsa-miR-4468	PAR-CLIP	20371350
MIRT504845	hsa-miR-514a-3p	PAR-CLIP	20371350
MIRT504844	hsa-miR-514b-3p	PAR-CLIP	20371350
MIRT504842	hsa-miR-8055	PAR-CLIP	20371350
MIRT016206	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT504855	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT504854	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031858	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT504853	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT504852	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT504851	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT504850	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT504848	hsa-miR-922	PAR-CLIP	20371350
MIRT504847	hsa-miR-4645-3p	PAR-CLIP	20371350
MIRT504846	hsa-miR-4468	PAR-CLIP	20371350
MIRT504845	hsa-miR-514a-3p	PAR-CLIP	20371350
MIRT504844	hsa-miR-514b-3p	PAR-CLIP	20371350
MIRT504842	hsa-miR-8055	PAR-CLIP	20371350
MIRT016206	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT504856	hsa-miR-7849-3p	PAR-CLIP	21572407
MIRT504855	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT504854	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031858	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT504853	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT504852	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT504851	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT504850	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT504849	hsa-miR-4666a-3p	PAR-CLIP	21572407
MIRT504848	hsa-miR-922	PAR-CLIP	21572407
MIRT504847	hsa-miR-4645-3p	PAR-CLIP	21572407
MIRT504846	hsa-miR-4468	PAR-CLIP	21572407
MIRT504845	hsa-miR-514a-3p	PAR-CLIP	21572407
MIRT504844	hsa-miR-514b-3p	PAR-CLIP	21572407
MIRT504842	hsa-miR-8055	PAR-CLIP	21572407
MIRT016206	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT504856	hsa-miR-7849-3p	PAR-CLIP	21572407
MIRT504855	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT504854	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031858	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT504853	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT504852	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT504851	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT504850	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT504849	hsa-miR-4666a-3p	PAR-CLIP	21572407
MIRT504848	hsa-miR-922	PAR-CLIP	21572407
MIRT504847	hsa-miR-4645-3p	PAR-CLIP	21572407
MIRT504846	hsa-miR-4468	PAR-CLIP	21572407
MIRT504845	hsa-miR-514a-3p	PAR-CLIP	21572407
MIRT504844	hsa-miR-514b-3p	PAR-CLIP	21572407
MIRT504842	hsa-miR-8055	PAR-CLIP	21572407
MIRT532311	hsa-miR-548c-3p	PAR-CLIP	22012620
MIRT532310	hsa-miR-1911-3p	PAR-CLIP	22012620
MIRT532309	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT532308	hsa-miR-562	PAR-CLIP	22012620
MIRT532307	hsa-miR-4438	PAR-CLIP	22012620
MIRT532306	hsa-miR-5697	PAR-CLIP	22012620
MIRT532305	hsa-miR-378a-3p	PAR-CLIP	22012620
MIRT532304	hsa-miR-378b	PAR-CLIP	22012620
MIRT532302	hsa-miR-378c	PAR-CLIP	22012620
MIRT532303	hsa-miR-378d	PAR-CLIP	22012620
MIRT532301	hsa-miR-378e	PAR-CLIP	22012620
MIRT532300	hsa-miR-378f	PAR-CLIP	22012620
MIRT532299	hsa-miR-378h	PAR-CLIP	22012620
MIRT532297	hsa-miR-378i	PAR-CLIP	22012620
MIRT532298	hsa-miR-422a	PAR-CLIP	22012620
MIRT532296	hsa-miR-6503-3p	PAR-CLIP	22012620
MIRT532295	hsa-miR-566	PAR-CLIP	22012620
MIRT532294	hsa-miR-5095	PAR-CLIP	22012620
MIRT532293	hsa-miR-7151-3p	PAR-CLIP	22012620
MIRT532292	hsa-miR-4300	PAR-CLIP	22012620
MIRT016206	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT504856	hsa-miR-7849-3p	PAR-CLIP	23446348
MIRT504855	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT504854	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT031858	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT504853	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT504852	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT504851	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT504850	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT504849	hsa-miR-4666a-3p	PAR-CLIP	23446348
MIRT504848	hsa-miR-922	PAR-CLIP	23446348
MIRT504847	hsa-miR-4645-3p	PAR-CLIP	23446348
MIRT504846	hsa-miR-4468	PAR-CLIP	23446348
MIRT504845	hsa-miR-514a-3p	PAR-CLIP	23446348
MIRT504844	hsa-miR-514b-3p	PAR-CLIP	23446348
MIRT504842	hsa-miR-8055	PAR-CLIP	23446348
MIRT491398	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT491397	hsa-miR-6089	PAR-CLIP	23592263
MIRT491396	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT491395	hsa-miR-8085	PAR-CLIP	23592263
MIRT491394	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT491393	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT491392	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT491391	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT491389	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT491390	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT491388	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT491387	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT491386	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT491385	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT491384	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT491383	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT491382	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT491381	hsa-miR-3689c	PAR-CLIP	23592263
MIRT491380	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT491379	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT491378	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT491377	hsa-miR-3122	PAR-CLIP	23592263
MIRT491376	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT491375	hsa-miR-887-5p	PAR-CLIP	23592263
MIRT491374	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT491385	hsa-miR-1273h-5p	PAR-CLIP	27292025
MIRT491393	hsa-miR-149-3p	PAR-CLIP	27292025
MIRT491384	hsa-miR-30b-3p	PAR-CLIP	27292025
MIRT491388	hsa-miR-30c-1-3p	PAR-CLIP	27292025
MIRT491387	hsa-miR-30c-2-3p	PAR-CLIP	27292025
MIRT491383	hsa-miR-3689a-3p	PAR-CLIP	27292025
MIRT491382	hsa-miR-3689b-3p	PAR-CLIP	27292025
MIRT491381	hsa-miR-3689c	PAR-CLIP	27292025
MIRT668017	hsa-miR-4252	PAR-CLIP	27292025
MIRT668017	hsa-miR-4252	PAR-CLIP	27292025
MIRT491392	hsa-miR-4728-5p	PAR-CLIP	27292025
MIRT491380	hsa-miR-6779-5p	PAR-CLIP	27292025
MIRT491379	hsa-miR-6780a-5p	PAR-CLIP	27292025
MIRT491391	hsa-miR-6785-5p	PAR-CLIP	27292025
MIRT491386	hsa-miR-6788-5p	PAR-CLIP	27292025
MIRT491390	hsa-miR-6799-5p	PAR-CLIP	27292025
MIRT491389	hsa-miR-6883-5p	PAR-CLIP	27292025
MIRT491394	hsa-miR-7106-5p	PAR-CLIP	27292025
MIRT491375	hsa-miR-887-5p	PAR-CLIP	27292025
MIRT668025	hsa-miR-939-3p	HITS-CLIP	27418678
MIRT532311	hsa-miR-548c-3p	HITS-CLIP	19536157
MIRT532310	hsa-miR-1911-3p	HITS-CLIP	19536157
MIRT532309	hsa-miR-3613-3p	HITS-CLIP	19536157
MIRT724781	hsa-miR-4645-5p	HITS-CLIP	19536157
MIRT724780	hsa-miR-4673	HITS-CLIP	19536157
MIRT724779	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT016206	hsa-miR-590-3p	HITS-CLIP	21572407
MIRT504856	hsa-miR-7849-3p	HITS-CLIP	21572407
MIRT504855	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT504854	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT031858	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT504853	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT504852	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT504851	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT504850	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT504849	hsa-miR-4666a-3p	HITS-CLIP	21572407
MIRT504848	hsa-miR-922	HITS-CLIP	21572407
MIRT504847	hsa-miR-4645-3p	HITS-CLIP	21572407
MIRT504846	hsa-miR-4468	HITS-CLIP	21572407
MIRT504845	hsa-miR-514a-3p	HITS-CLIP	21572407
MIRT504844	hsa-miR-514b-3p	HITS-CLIP	21572407
MIRT668029	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT668028	hsa-miR-5586-3p	HITS-CLIP	23824327
MIRT668027	hsa-miR-5694	HITS-CLIP	23824327
MIRT668026	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT668025	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT668024	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT668023	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT668022	hsa-miR-1285-3p	HITS-CLIP	23824327
MIRT668021	hsa-miR-3187-5p	HITS-CLIP	23824327
MIRT668020	hsa-miR-5189-5p	HITS-CLIP	23824327
MIRT668019	hsa-miR-612	HITS-CLIP	23824327
MIRT668018	hsa-miR-6860	HITS-CLIP	23824327
MIRT668017	hsa-miR-4252	HITS-CLIP	23824327
MIRT668016	hsa-miR-661	HITS-CLIP	23824327
MIRT668015	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT668014	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT668013	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT668012	hsa-miR-7703	HITS-CLIP	23824327
MIRT504855	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT504854	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031858	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT504853	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT504852	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT504851	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT504850	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT504848	hsa-miR-922	PAR-CLIP	20371350
MIRT504847	hsa-miR-4645-3p	PAR-CLIP	20371350
MIRT504846	hsa-miR-4468	PAR-CLIP	20371350
MIRT504845	hsa-miR-514a-3p	PAR-CLIP	20371350
MIRT504844	hsa-miR-514b-3p	PAR-CLIP	20371350
MIRT504842	hsa-miR-8055	PAR-CLIP	20371350
MIRT016206	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT504855	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT504854	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031858	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT504853	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT504852	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT504851	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT504850	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT504848	hsa-miR-922	PAR-CLIP	20371350
MIRT504847	hsa-miR-4645-3p	PAR-CLIP	20371350
MIRT504846	hsa-miR-4468	PAR-CLIP	20371350
MIRT504845	hsa-miR-514a-3p	PAR-CLIP	20371350
MIRT504844	hsa-miR-514b-3p	PAR-CLIP	20371350
MIRT504842	hsa-miR-8055	PAR-CLIP	20371350
MIRT016206	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT504856	hsa-miR-7849-3p	PAR-CLIP	21572407
MIRT504855	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT504854	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031858	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT504853	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT504852	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT504851	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT504850	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT504849	hsa-miR-4666a-3p	PAR-CLIP	21572407
MIRT504848	hsa-miR-922	PAR-CLIP	21572407
MIRT504847	hsa-miR-4645-3p	PAR-CLIP	21572407
MIRT504846	hsa-miR-4468	PAR-CLIP	21572407
MIRT504845	hsa-miR-514a-3p	PAR-CLIP	21572407
MIRT504844	hsa-miR-514b-3p	PAR-CLIP	21572407
MIRT504842	hsa-miR-8055	PAR-CLIP	21572407
MIRT016206	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT504856	hsa-miR-7849-3p	PAR-CLIP	21572407
MIRT504855	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT504854	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031858	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT504853	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT504852	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT504851	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT504850	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT504849	hsa-miR-4666a-3p	PAR-CLIP	21572407
MIRT504848	hsa-miR-922	PAR-CLIP	21572407
MIRT504847	hsa-miR-4645-3p	PAR-CLIP	21572407
MIRT504846	hsa-miR-4468	PAR-CLIP	21572407
MIRT504845	hsa-miR-514a-3p	PAR-CLIP	21572407
MIRT504844	hsa-miR-514b-3p	PAR-CLIP	21572407
MIRT504842	hsa-miR-8055	PAR-CLIP	21572407
MIRT532311	hsa-miR-548c-3p	PAR-CLIP	22012620
MIRT532310	hsa-miR-1911-3p	PAR-CLIP	22012620
MIRT532309	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT532308	hsa-miR-562	PAR-CLIP	22012620
MIRT532307	hsa-miR-4438	PAR-CLIP	22012620
MIRT532306	hsa-miR-5697	PAR-CLIP	22012620
MIRT532305	hsa-miR-378a-3p	PAR-CLIP	22012620
MIRT532304	hsa-miR-378b	PAR-CLIP	22012620
MIRT532302	hsa-miR-378c	PAR-CLIP	22012620
MIRT532303	hsa-miR-378d	PAR-CLIP	22012620
MIRT532301	hsa-miR-378e	PAR-CLIP	22012620
MIRT532300	hsa-miR-378f	PAR-CLIP	22012620
MIRT532299	hsa-miR-378h	PAR-CLIP	22012620
MIRT532297	hsa-miR-378i	PAR-CLIP	22012620
MIRT532298	hsa-miR-422a	PAR-CLIP	22012620
MIRT532296	hsa-miR-6503-3p	PAR-CLIP	22012620
MIRT532295	hsa-miR-566	PAR-CLIP	22012620
MIRT532294	hsa-miR-5095	PAR-CLIP	22012620
MIRT532293	hsa-miR-7151-3p	PAR-CLIP	22012620
MIRT532292	hsa-miR-4300	PAR-CLIP	22012620
MIRT016206	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT504856	hsa-miR-7849-3p	PAR-CLIP	23446348
MIRT504855	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT504854	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT031858	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT504853	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT504852	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT504851	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT504850	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT504849	hsa-miR-4666a-3p	PAR-CLIP	23446348
MIRT504848	hsa-miR-922	PAR-CLIP	23446348
MIRT504847	hsa-miR-4645-3p	PAR-CLIP	23446348
MIRT504846	hsa-miR-4468	PAR-CLIP	23446348
MIRT504845	hsa-miR-514a-3p	PAR-CLIP	23446348
MIRT504844	hsa-miR-514b-3p	PAR-CLIP	23446348
MIRT504842	hsa-miR-8055	PAR-CLIP	23446348
MIRT491398	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT491397	hsa-miR-6089	PAR-CLIP	23592263
MIRT491396	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT491395	hsa-miR-8085	PAR-CLIP	23592263
MIRT491394	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT491393	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT491392	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT491391	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT491389	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT491390	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT491388	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT491387	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT491386	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT491385	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT491384	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT491383	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT491382	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT491381	hsa-miR-3689c	PAR-CLIP	23592263
MIRT491380	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT491379	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT491378	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT491377	hsa-miR-3122	PAR-CLIP	23592263
MIRT491376	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT491375	hsa-miR-887-5p	PAR-CLIP	23592263
MIRT491374	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT1041083	hsa-miR-1193	CLIP-seq
MIRT1041084	hsa-miR-1202	CLIP-seq
MIRT1041085	hsa-miR-1272	CLIP-seq
MIRT1041086	hsa-miR-1285	CLIP-seq
MIRT1041087	hsa-miR-139-5p	CLIP-seq
MIRT1041088	hsa-miR-151-3p	CLIP-seq
MIRT1041089	hsa-miR-15a	CLIP-seq
MIRT1041090	hsa-miR-15b	CLIP-seq
MIRT1041091	hsa-miR-16	CLIP-seq
MIRT1041092	hsa-miR-195	CLIP-seq
MIRT1041093	hsa-miR-1972	CLIP-seq
MIRT1041094	hsa-miR-1976	CLIP-seq
MIRT1041095	hsa-miR-200b	CLIP-seq
MIRT1041096	hsa-miR-200c	CLIP-seq
MIRT1041097	hsa-miR-2114	CLIP-seq
MIRT1041098	hsa-miR-2392	CLIP-seq
MIRT1041099	hsa-miR-23a	CLIP-seq
MIRT1041100	hsa-miR-23b	CLIP-seq
MIRT1041101	hsa-miR-23c	CLIP-seq
MIRT1041102	hsa-miR-3152-3p	CLIP-seq
MIRT1041103	hsa-miR-3165	CLIP-seq
MIRT1041104	hsa-miR-3184	CLIP-seq
MIRT1041105	hsa-miR-3192	CLIP-seq
MIRT1041106	hsa-miR-3194-5p	CLIP-seq
MIRT1041107	hsa-miR-3197	CLIP-seq
MIRT1041108	hsa-miR-335	CLIP-seq
MIRT1041109	hsa-miR-34b	CLIP-seq
MIRT1041110	hsa-miR-3618	CLIP-seq
MIRT1041111	hsa-miR-3622a-3p	CLIP-seq
MIRT1041112	hsa-miR-3622b-3p	CLIP-seq
MIRT1041113	hsa-miR-3622b-5p	CLIP-seq
MIRT1041114	hsa-miR-3646	CLIP-seq
MIRT1041115	hsa-miR-3647-3p	CLIP-seq
MIRT1041116	hsa-miR-365	CLIP-seq
MIRT1041117	hsa-miR-3656	CLIP-seq
MIRT1041118	hsa-miR-3662	CLIP-seq
MIRT1041119	hsa-miR-3664-5p	CLIP-seq
MIRT1041120	hsa-miR-3672	CLIP-seq
MIRT1041121	hsa-miR-371-5p	CLIP-seq
MIRT1041122	hsa-miR-371b-5p	CLIP-seq
MIRT1041123	hsa-miR-3926	CLIP-seq
MIRT1041124	hsa-miR-3972	CLIP-seq
MIRT1041125	hsa-miR-3974	CLIP-seq
MIRT1041126	hsa-miR-423-5p	CLIP-seq
MIRT1041127	hsa-miR-424	CLIP-seq
MIRT1041128	hsa-miR-4253	CLIP-seq
MIRT1041129	hsa-miR-4279	CLIP-seq
MIRT1041130	hsa-miR-4282	CLIP-seq
MIRT1041131	hsa-miR-429	CLIP-seq
MIRT1041132	hsa-miR-4293	CLIP-seq
MIRT1041133	hsa-miR-4433	CLIP-seq
MIRT1041134	hsa-miR-4436b-5p	CLIP-seq
MIRT1041135	hsa-miR-4455	CLIP-seq
MIRT1041136	hsa-miR-4459	CLIP-seq
MIRT1041137	hsa-miR-4461	CLIP-seq
MIRT1041138	hsa-miR-4463	CLIP-seq
MIRT1041139	hsa-miR-4477a	CLIP-seq
MIRT1041140	hsa-miR-4494	CLIP-seq
MIRT1041141	hsa-miR-4499	CLIP-seq
MIRT1041142	hsa-miR-4509	CLIP-seq
MIRT1041143	hsa-miR-4514	CLIP-seq
MIRT1041144	hsa-miR-4536	CLIP-seq
MIRT1041145	hsa-miR-4537	CLIP-seq
MIRT1041146	hsa-miR-4539	CLIP-seq
MIRT1041147	hsa-miR-4652-5p	CLIP-seq
MIRT1041148	hsa-miR-4662a-5p	CLIP-seq
MIRT1041149	hsa-miR-4663	CLIP-seq
MIRT1041150	hsa-miR-4666-3p	CLIP-seq
MIRT1041151	hsa-miR-4676-5p	CLIP-seq
MIRT1041152	hsa-miR-4680-5p	CLIP-seq
MIRT1041153	hsa-miR-4690-5p	CLIP-seq
MIRT1041154	hsa-miR-4692	CLIP-seq
MIRT1041155	hsa-miR-4714-5p	CLIP-seq
MIRT1041156	hsa-miR-4722-3p	CLIP-seq
MIRT1041157	hsa-miR-4724-5p	CLIP-seq
MIRT1041158	hsa-miR-4738-3p	CLIP-seq
MIRT1041159	hsa-miR-4786-5p	CLIP-seq
MIRT1041160	hsa-miR-4793-5p	CLIP-seq
MIRT1041161	hsa-miR-4796-5p	CLIP-seq
MIRT1041162	hsa-miR-4802-5p	CLIP-seq
MIRT1041163	hsa-miR-490-3p	CLIP-seq
MIRT1041164	hsa-miR-497	CLIP-seq
MIRT1041165	hsa-miR-499a-5p	CLIP-seq
MIRT1041166	hsa-miR-514	CLIP-seq
MIRT1041167	hsa-miR-544b	CLIP-seq
MIRT1041168	hsa-miR-548m	CLIP-seq
MIRT1041169	hsa-miR-548s	CLIP-seq
MIRT1041170	hsa-miR-575	CLIP-seq
MIRT1041171	hsa-miR-609	CLIP-seq
MIRT1041172	hsa-miR-633	CLIP-seq
MIRT1041173	hsa-miR-640	CLIP-seq
MIRT1041174	hsa-miR-644	CLIP-seq
MIRT1041175	hsa-miR-658	CLIP-seq
MIRT1041176	hsa-miR-764	CLIP-seq
MIRT1041177	hsa-miR-765	CLIP-seq
MIRT1041178	hsa-miR-766	CLIP-seq
MIRT1041179	hsa-miR-769-5p	CLIP-seq
MIRT1041180	hsa-miR-933	CLIP-seq
MIRT2008600	hsa-miR-106a	CLIP-seq
MIRT2008601	hsa-miR-106b	CLIP-seq
MIRT1041084	hsa-miR-1202	CLIP-seq
MIRT2008602	hsa-miR-1227	CLIP-seq
MIRT2008603	hsa-miR-1234	CLIP-seq
MIRT1041086	hsa-miR-1285	CLIP-seq
MIRT2008604	hsa-miR-129-5p	CLIP-seq
MIRT2008605	hsa-miR-150	CLIP-seq
MIRT1041088	hsa-miR-151-3p	CLIP-seq
MIRT2008606	hsa-miR-17	CLIP-seq
MIRT2008607	hsa-miR-1912	CLIP-seq
MIRT1041094	hsa-miR-1976	CLIP-seq
MIRT2008608	hsa-miR-20a	CLIP-seq
MIRT2008609	hsa-miR-20b	CLIP-seq
MIRT1041097	hsa-miR-2114	CLIP-seq
MIRT2008610	hsa-miR-302a	CLIP-seq
MIRT2008611	hsa-miR-302b	CLIP-seq
MIRT2008612	hsa-miR-302c	CLIP-seq
MIRT2008613	hsa-miR-302d	CLIP-seq
MIRT2008614	hsa-miR-302e	CLIP-seq
MIRT2008615	hsa-miR-3132	CLIP-seq
MIRT2008616	hsa-miR-3149	CLIP-seq
MIRT2008617	hsa-miR-3160-3p	CLIP-seq
MIRT1041105	hsa-miR-3192	CLIP-seq
MIRT1041106	hsa-miR-3194-5p	CLIP-seq
MIRT1041109	hsa-miR-34b	CLIP-seq
MIRT1041116	hsa-miR-365	CLIP-seq
MIRT2008618	hsa-miR-3659	CLIP-seq
MIRT1041120	hsa-miR-3672	CLIP-seq
MIRT2008619	hsa-miR-3714	CLIP-seq
MIRT2008620	hsa-miR-372	CLIP-seq
MIRT2008621	hsa-miR-373	CLIP-seq
MIRT2008622	hsa-miR-3908	CLIP-seq
MIRT1041123	hsa-miR-3926	CLIP-seq
MIRT1041124	hsa-miR-3972	CLIP-seq
MIRT2008623	hsa-miR-411	CLIP-seq
MIRT1041129	hsa-miR-4279	CLIP-seq
MIRT1041132	hsa-miR-4293	CLIP-seq
MIRT2008624	hsa-miR-4422	CLIP-seq
MIRT1041133	hsa-miR-4433	CLIP-seq
MIRT1041136	hsa-miR-4459	CLIP-seq
MIRT2008625	hsa-miR-4487	CLIP-seq
MIRT1041145	hsa-miR-4537	CLIP-seq
MIRT1041146	hsa-miR-4539	CLIP-seq
MIRT1041150	hsa-miR-4666-3p	CLIP-seq
MIRT1041152	hsa-miR-4680-5p	CLIP-seq
MIRT2008626	hsa-miR-4693-3p	CLIP-seq
MIRT1041156	hsa-miR-4722-3p	CLIP-seq
MIRT2008627	hsa-miR-4731-5p	CLIP-seq
MIRT1041158	hsa-miR-4738-3p	CLIP-seq
MIRT2008628	hsa-miR-4765	CLIP-seq
MIRT1041159	hsa-miR-4786-5p	CLIP-seq
MIRT1041163	hsa-miR-490-3p	CLIP-seq
MIRT2008629	hsa-miR-493	CLIP-seq
MIRT2008630	hsa-miR-512-3p	CLIP-seq
MIRT2008631	hsa-miR-519d	CLIP-seq
MIRT2008632	hsa-miR-520a-3p	CLIP-seq
MIRT2008633	hsa-miR-520b	CLIP-seq
MIRT2008634	hsa-miR-520c-3p	CLIP-seq
MIRT2008635	hsa-miR-520d-3p	CLIP-seq
MIRT2008636	hsa-miR-520e	CLIP-seq
MIRT2008637	hsa-miR-520g	CLIP-seq
MIRT2008638	hsa-miR-520h	CLIP-seq
MIRT1041167	hsa-miR-544b	CLIP-seq
MIRT1041168	hsa-miR-548m	CLIP-seq
MIRT1041169	hsa-miR-548s	CLIP-seq
MIRT2008639	hsa-miR-558	CLIP-seq
MIRT2008640	hsa-miR-642b	CLIP-seq
MIRT1041175	hsa-miR-658	CLIP-seq
MIRT1041178	hsa-miR-766	CLIP-seq
MIRT1041179	hsa-miR-769-5p	CLIP-seq
MIRT2008641	hsa-miR-93	CLIP-seq
MIRT1041180	hsa-miR-933	CLIP-seq
MIRT2008600	hsa-miR-106a	CLIP-seq
MIRT2008601	hsa-miR-106b	CLIP-seq
MIRT2008602	hsa-miR-1227	CLIP-seq
MIRT2008603	hsa-miR-1234	CLIP-seq
MIRT2241025	hsa-miR-125a-3p	CLIP-seq
MIRT1041086	hsa-miR-1285	CLIP-seq
MIRT2008604	hsa-miR-129-5p	CLIP-seq
MIRT2241026	hsa-miR-1343	CLIP-seq
MIRT1041087	hsa-miR-139-5p	CLIP-seq
MIRT2241027	hsa-miR-146a	CLIP-seq
MIRT2241028	hsa-miR-146b-5p	CLIP-seq
MIRT2008605	hsa-miR-150	CLIP-seq
MIRT1041088	hsa-miR-151-3p	CLIP-seq
MIRT2008606	hsa-miR-17	CLIP-seq
MIRT2241029	hsa-miR-192	CLIP-seq
MIRT2241030	hsa-miR-197	CLIP-seq
MIRT1041094	hsa-miR-1976	CLIP-seq
MIRT2008608	hsa-miR-20a	CLIP-seq
MIRT2008609	hsa-miR-20b	CLIP-seq
MIRT1041097	hsa-miR-2114	CLIP-seq
MIRT2241031	hsa-miR-215	CLIP-seq
MIRT1041099	hsa-miR-23a	CLIP-seq
MIRT1041100	hsa-miR-23b	CLIP-seq
MIRT1041101	hsa-miR-23c	CLIP-seq
MIRT2008610	hsa-miR-302a	CLIP-seq
MIRT2008611	hsa-miR-302b	CLIP-seq
MIRT2008612	hsa-miR-302c	CLIP-seq
MIRT2008613	hsa-miR-302d	CLIP-seq
MIRT2008614	hsa-miR-302e	CLIP-seq
MIRT2008615	hsa-miR-3132	CLIP-seq
MIRT2008617	hsa-miR-3160-3p	CLIP-seq
MIRT2241032	hsa-miR-3163	CLIP-seq
MIRT1041103	hsa-miR-3165	CLIP-seq
MIRT1041104	hsa-miR-3184	CLIP-seq
MIRT1041105	hsa-miR-3192	CLIP-seq
MIRT1041107	hsa-miR-3197	CLIP-seq
MIRT1041109	hsa-miR-34b	CLIP-seq
MIRT1041110	hsa-miR-3618	CLIP-seq
MIRT1041111	hsa-miR-3622a-3p	CLIP-seq
MIRT1041112	hsa-miR-3622b-3p	CLIP-seq
MIRT1041115	hsa-miR-3647-3p	CLIP-seq
MIRT1041117	hsa-miR-3656	CLIP-seq
MIRT2008618	hsa-miR-3659	CLIP-seq
MIRT2241033	hsa-miR-3661	CLIP-seq
MIRT1041120	hsa-miR-3672	CLIP-seq
MIRT2241034	hsa-miR-3675-3p	CLIP-seq
MIRT2008620	hsa-miR-372	CLIP-seq
MIRT2008621	hsa-miR-373	CLIP-seq
MIRT2241035	hsa-miR-378	CLIP-seq
MIRT2241036	hsa-miR-378g	CLIP-seq
MIRT2008622	hsa-miR-3908	CLIP-seq
MIRT1041123	hsa-miR-3926	CLIP-seq
MIRT1041125	hsa-miR-3974	CLIP-seq
MIRT1041126	hsa-miR-423-5p	CLIP-seq
MIRT2241037	hsa-miR-4251	CLIP-seq
MIRT1041129	hsa-miR-4279	CLIP-seq
MIRT1041132	hsa-miR-4293	CLIP-seq
MIRT2241038	hsa-miR-4324	CLIP-seq
MIRT2008624	hsa-miR-4422	CLIP-seq
MIRT1041133	hsa-miR-4433	CLIP-seq
MIRT1041136	hsa-miR-4459	CLIP-seq
MIRT1041138	hsa-miR-4463	CLIP-seq
MIRT1041139	hsa-miR-4477a	CLIP-seq
MIRT2008625	hsa-miR-4487	CLIP-seq
MIRT1041141	hsa-miR-4499	CLIP-seq
MIRT1041145	hsa-miR-4537	CLIP-seq
MIRT2241039	hsa-miR-4643	CLIP-seq
MIRT1041147	hsa-miR-4652-5p	CLIP-seq
MIRT2241040	hsa-miR-466	CLIP-seq
MIRT1041150	hsa-miR-4666-3p	CLIP-seq
MIRT2241041	hsa-miR-4678	CLIP-seq
MIRT1041156	hsa-miR-4722-3p	CLIP-seq
MIRT1041157	hsa-miR-4724-5p	CLIP-seq
MIRT2008627	hsa-miR-4731-5p	CLIP-seq
MIRT2241042	hsa-miR-4735-5p	CLIP-seq
MIRT2241043	hsa-miR-4775	CLIP-seq
MIRT1041159	hsa-miR-4786-5p	CLIP-seq
MIRT2241044	hsa-miR-4789-3p	CLIP-seq
MIRT1041163	hsa-miR-490-3p	CLIP-seq
MIRT2008629	hsa-miR-493	CLIP-seq
MIRT2008630	hsa-miR-512-3p	CLIP-seq
MIRT1041166	hsa-miR-514	CLIP-seq
MIRT2008631	hsa-miR-519d	CLIP-seq
MIRT2008632	hsa-miR-520a-3p	CLIP-seq
MIRT2008633	hsa-miR-520b	CLIP-seq
MIRT2008634	hsa-miR-520c-3p	CLIP-seq
MIRT2008635	hsa-miR-520d-3p	CLIP-seq
MIRT2008636	hsa-miR-520e	CLIP-seq
MIRT2008637	hsa-miR-520g	CLIP-seq
MIRT2008638	hsa-miR-520h	CLIP-seq
MIRT1041167	hsa-miR-544b	CLIP-seq
MIRT1041168	hsa-miR-548m	CLIP-seq
MIRT1041169	hsa-miR-548s	CLIP-seq
MIRT2241045	hsa-miR-552	CLIP-seq
MIRT2008639	hsa-miR-558	CLIP-seq
MIRT2241046	hsa-miR-568	CLIP-seq
MIRT2241047	hsa-miR-589	CLIP-seq
MIRT2241048	hsa-miR-631	CLIP-seq
MIRT1041175	hsa-miR-658	CLIP-seq
MIRT1041176	hsa-miR-764	CLIP-seq
MIRT1041178	hsa-miR-766	CLIP-seq
MIRT1041179	hsa-miR-769-5p	CLIP-seq
MIRT2241049	hsa-miR-920	CLIP-seq
MIRT2008641	hsa-miR-93	CLIP-seq
MIRT2241050	hsa-miR-944	CLIP-seq
MIRT2388908	hsa-miR-1207-5p	CLIP-seq
MIRT2388909	hsa-miR-1909	CLIP-seq
MIRT1041097	hsa-miR-2114	CLIP-seq
MIRT1041099	hsa-miR-23a	CLIP-seq
MIRT1041100	hsa-miR-23b	CLIP-seq
MIRT1041101	hsa-miR-23c	CLIP-seq
MIRT1041104	hsa-miR-3184	CLIP-seq
MIRT1041109	hsa-miR-34b	CLIP-seq
MIRT1041113	hsa-miR-3622b-5p	CLIP-seq
MIRT1041115	hsa-miR-3647-3p	CLIP-seq
MIRT1041126	hsa-miR-423-5p	CLIP-seq
MIRT1041128	hsa-miR-4253	CLIP-seq
MIRT1041147	hsa-miR-4652-5p	CLIP-seq
MIRT2388910	hsa-miR-4688	CLIP-seq
MIRT2388911	hsa-miR-4705	CLIP-seq
MIRT2388912	hsa-miR-4763-3p	CLIP-seq
MIRT1041163	hsa-miR-490-3p	CLIP-seq
MIRT1041180	hsa-miR-933	CLIP-seq
MIRT2450970	hsa-miR-1180	CLIP-seq
MIRT2241027	hsa-miR-146a	CLIP-seq
MIRT2241028	hsa-miR-146b-5p	CLIP-seq
MIRT1041105	hsa-miR-3192	CLIP-seq
MIRT1041109	hsa-miR-34b	CLIP-seq
MIRT1041115	hsa-miR-3647-3p	CLIP-seq
MIRT2241033	hsa-miR-3661	CLIP-seq
MIRT2241037	hsa-miR-4251	CLIP-seq
MIRT2241038	hsa-miR-4324	CLIP-seq
MIRT2008624	hsa-miR-4422	CLIP-seq
MIRT1041157	hsa-miR-4724-5p	CLIP-seq
MIRT1041163	hsa-miR-490-3p	CLIP-seq
MIRT2241047	hsa-miR-589	CLIP-seq
MIRT2241048	hsa-miR-631	CLIP-seq
MIRT1041175	hsa-miR-658	CLIP-seq
MIRT1041105	hsa-miR-3192	CLIP-seq
MIRT1041109	hsa-miR-34b	CLIP-seq
MIRT1041115	hsa-miR-3647-3p	CLIP-seq
MIRT1041157	hsa-miR-4724-5p	CLIP-seq
MIRT1041163	hsa-miR-490-3p	CLIP-seq
MIRT1041175	hsa-miR-658	CLIP-seq
MIRT2450970	hsa-miR-1180	CLIP-seq
MIRT1041085	hsa-miR-1272	CLIP-seq
MIRT1041086	hsa-miR-1285	CLIP-seq
MIRT1041097	hsa-miR-2114	CLIP-seq
MIRT1041098	hsa-miR-2392	CLIP-seq
MIRT1041102	hsa-miR-3152-3p	CLIP-seq
MIRT1041105	hsa-miR-3192	CLIP-seq
MIRT1041109	hsa-miR-34b	CLIP-seq
MIRT1041115	hsa-miR-3647-3p	CLIP-seq
MIRT1041120	hsa-miR-3672	CLIP-seq
MIRT1041121	hsa-miR-371-5p	CLIP-seq
MIRT1041122	hsa-miR-371b-5p	CLIP-seq
MIRT1041145	hsa-miR-4537	CLIP-seq
MIRT1041148	hsa-miR-4662a-5p	CLIP-seq
MIRT1041151	hsa-miR-4676-5p	CLIP-seq
MIRT1041157	hsa-miR-4724-5p	CLIP-seq
MIRT1041158	hsa-miR-4738-3p	CLIP-seq
MIRT2544609	hsa-miR-4797-5p	CLIP-seq
MIRT1041163	hsa-miR-490-3p	CLIP-seq
MIRT1041167	hsa-miR-544b	CLIP-seq
MIRT1041170	hsa-miR-575	CLIP-seq
MIRT1041175	hsa-miR-658	CLIP-seq
MIRT2544610	hsa-miR-759	CLIP-seq
MIRT1041178	hsa-miR-766	CLIP-seq
MIRT2450970	hsa-miR-1180	CLIP-seq
MIRT1041085	hsa-miR-1272	CLIP-seq
MIRT1041086	hsa-miR-1285	CLIP-seq
MIRT1041097	hsa-miR-2114	CLIP-seq
MIRT1041102	hsa-miR-3152-3p	CLIP-seq
MIRT1041105	hsa-miR-3192	CLIP-seq
MIRT1041109	hsa-miR-34b	CLIP-seq
MIRT1041115	hsa-miR-3647-3p	CLIP-seq
MIRT1041120	hsa-miR-3672	CLIP-seq
MIRT1041121	hsa-miR-371-5p	CLIP-seq
MIRT1041122	hsa-miR-371b-5p	CLIP-seq
MIRT1041123	hsa-miR-3926	CLIP-seq
MIRT1041145	hsa-miR-4537	CLIP-seq
MIRT1041148	hsa-miR-4662a-5p	CLIP-seq
MIRT1041151	hsa-miR-4676-5p	CLIP-seq
MIRT1041157	hsa-miR-4724-5p	CLIP-seq
MIRT1041158	hsa-miR-4738-3p	CLIP-seq
MIRT1041159	hsa-miR-4786-5p	CLIP-seq
MIRT1041160	hsa-miR-4793-5p	CLIP-seq
MIRT2544609	hsa-miR-4797-5p	CLIP-seq
MIRT1041163	hsa-miR-490-3p	CLIP-seq
MIRT1041169	hsa-miR-548s	CLIP-seq
MIRT1041170	hsa-miR-575	CLIP-seq
MIRT1041175	hsa-miR-658	CLIP-seq
MIRT2544610	hsa-miR-759	CLIP-seq
MIRT1041178	hsa-miR-766	CLIP-seq
MIRT1041179	hsa-miR-769-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	19369198, 20360068, 24981860, 25416956, 30723163, 32296183, 32814053
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005813	Component	Centrosome	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005929	Component	Cilium	IDA
GO:0007098	Process	Centrosome cycle	IMP	19427217
GO:0007098	Process	Centrosome cycle	NAS	20360068
GO:0010968	Process	Regulation of microtubule nucleation	NAS	30044976
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0031023	Process	Microtubule organizing center organization	IBA
GO:0036064	Component	Ciliary basal body	IDA
GO:0045171	Component	Intercellular bridge	IDA
GO:0051225	Process	Spindle assembly	IBA
GO:0051225	Process	Spindle assembly	IEA
GO:0051225	Process	Spindle assembly	IMP	19369198, 19427217
GO:0051225	Process	Spindle assembly	NAS	20360068
GO:0051301	Process	Cell division	IEA
GO:0070652	Component	HAUS complex	IBA
GO:0070652	Component	HAUS complex	IDA	19369198, 19427217
GO:0070652	Component	HAUS complex	IEA
GO:0070652	Component	HAUS complex	IPI	20360068
GO:0072686	Component	Mitotic spindle	IBA
GO:0072686	Component	Mitotic spindle	IDA
GO:1990498	Component	Mitotic spindle microtubule	IDA	30723163

Other IDs

• MIM: 613430
• HGNC: 28719
• e!Ensembl: ENSG00000214367

Protein

• UniProt ID: Q68CZ6
• Protein name: HAUS augmin-like complex subunit 3
• Protein function: Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.
• PDB: 6PTB , 6PTE , 7SQK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14932	HAUS-augmin3	29 → 282	HAUS augmin-like complex subunit 3	Family

• Sequence:

  MSCGNEFVETLKKIGYPKADNLNGEDFDWLFEGVEDESFLKWFCGNVNEQNVLSERELEA
  FSILQKSGKPILEGAALDEALKTCKTSDLKTPRLDDKELEKLEDEVQTLLKLKNLKIQRR
  NKCQLMASVTSHKSLRLNAKEEEATKKLKQSQGILNAMITKISNELQALTDEVTQLMMFF
  RHSNLGQGTNPLVFLSQFSLEKYLSQEEQSTAALTLYTKKQFFQGIHEVVESSNEDNFQL
  LDIQTPSICDNQEILEERRLEMARLQLAYICAQHQLIHLKASNSSMKSSIKWAEESLHSL
  TSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVVRENAQLLNMPVVKGDFDLQI
  AKQDYYTARQELVLNQLIKQKASFELLQLSYEIELRKHRDIYRQLENLVQELSQSNMMLY
  KQLEMLTDPSVSQQINPRNTIDTKDYSTHRLYQVLEGENKKKELFLTHGNLEEVAEKLKQ
  NISLVQDQLAVSAQEHSFFLSKRNKDVDMLCDTLYQGGNQLLLSDQELTEQFHKVESQLN
  KLNHLLTDILADVKTKRKTLANNKLHQMEREFYVYFLKDEDYLKDIVENLETQSKIKAVS
  LED

• Sequence length: 603

Pathways

Reactome Pathway

Regulation of PLK1 Activity at G2/M Transition

Loss of Nlp from mitotic centrosomes

Recruitment of mitotic centrosome proteins and complexes

Loss of proteins required for interphase microtubule organization from the centrosome

Recruitment of NuMA to mitotic centrosomes

Anchoring of the basal body to the plasma membrane

AURKA Activation by TPX2

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Familial cancer of breast	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (44)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autoimmune Diseases	Autoimmune disease	Pubtator	35220890	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25742952, 28651500, 30104400, 36274054, 36376369	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29410498	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25742952, 28720069, 29214989	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28651500, 31646558, 32733618	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29214989	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27667152	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28770969	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25337221	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26499888	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	30231249, 36281164	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27391336	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28099409, 28651500, 28720069, 29410498, 34163032	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36477008	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33381557, 36525280	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25337221, 27453415, 28651500	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26883252	Stimulate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	27902971	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26464658	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27460732	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31545272	Inhibit	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35813414	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	35220890	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35069789	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	25337221	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31031853		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27662619, 29410498	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25973088, 26883252	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28770969	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31031853		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24223182, 25344859, 28651500, 29410498	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31031853		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31799644	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27667152	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28691641, 33576454	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34163032	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29489909	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	34969359	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	31403267	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33683834, 37232821	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25835973, 28651500, 35739527	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	29300379	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25973088	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30268126	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SDCCAG8 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes. CEP250 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes. HAUS1 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes. NEDD1 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes. CEP164 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SDCCAG8	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]
CEP250	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]
HAUS1	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]
NEDD1	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]
CEP164	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]

Diseases Linked via Similar Genes

Retinitis pigmentosa Linked via 3 of 5 related genesSDCCAG8, CEP250, CEP164 Ciliopathy Linked via 2 of 5 related genesSDCCAG8, CEP164 Metabolic syndrome Linked via 2 of 5 related genesSDCCAG8, CEP164 Nephronophthisis Linked via 2 of 5 related genesSDCCAG8, CEP164 Senior-loken syndrome Linked via 2 of 5 related genesSDCCAG8, CEP164

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Retinitis pigmentosa	3	["SDCCAG8","CEP250","CEP164"]
Ciliopathy	2	["SDCCAG8","CEP164"]
Metabolic syndrome	2	["SDCCAG8","CEP164"]
Nephronophthisis	2	["SDCCAG8","CEP164"]
Senior-loken syndrome	2	["SDCCAG8","CEP164"]