H2AC12 (H2A clustered histone 12)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 85235
Gene name H2A clustered histone 12
Gene symbol H2AC12
Synonyms (NCBI Gene)
H2A/SH2AFALiiH2AHHIST1H2AHdJ86C11.1
Chromosome 6
Chromosome location 6p22.1
Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000786 Component Nucleosome IBA
GO:0000786 Component Nucleosome IEA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
615013 13671 ENSG00000274997
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96KK5
Protein name Histone H2A type 1-H (H2A-clustered histone 12) (Histone H2A/s)
Protein function Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair,
PDB 8OL1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00125 Histone 2 → 91 Core histone H2A/H2B/H3/H4 Domain
PF16211 Histone_H2A_C 92 → 126 C-terminus of histone H2A Family
Sequence 
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAK
Sequence length 128
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
ATP-dependent chromatin remodeling HDACs deacetylate histones
Necroptosis HATs acetylate histones
Neutrophil extracellular trap formation RMTs methylate histone arginines
Alcoholism UCH proteinases
Systemic lupus erythematosus Ub-specific processing proteases
  Metalloprotease DUBs
  HCMV Early Events
  HCMV Late Events
Sort by:
H2AC1 13 shared pathwaysATP-dependent chromatin remodeling, Necroptosis, Neutrophil extracellular trap formation, Alcoholism, Systemic lupus erythematosus, Ub-specific processing proteases, HCMV Late Events, HCMV Early Events, RMTs methylate histone arginines, UCH proteinases, Metalloprotease DUBs, HDACs deacetylate histones +1 more Related via 13 shared pathways including ATP-dependent chromatin remodeling, Necroptosis. H2AC21 13 shared pathwaysATP-dependent chromatin remodeling, Necroptosis, Neutrophil extracellular trap formation, Alcoholism, Systemic lupus erythematosus, Ub-specific processing proteases, HCMV Late Events, HCMV Early Events, RMTs methylate histone arginines, UCH proteinases, Metalloprotease DUBs, HDACs deacetylate histones +1 more Related via 13 shared pathways including ATP-dependent chromatin remodeling, Necroptosis. H2AC13 13 shared pathwaysATP-dependent chromatin remodeling, Necroptosis, Neutrophil extracellular trap formation, Alcoholism, Systemic lupus erythematosus, Ub-specific processing proteases, HCMV Late Events, HCMV Early Events, RMTs methylate histone arginines, UCH proteinases, Metalloprotease DUBs, HDACs deacetylate histones +1 more Related via 13 shared pathways including ATP-dependent chromatin remodeling, Necroptosis. H2AC15 13 shared pathwaysATP-dependent chromatin remodeling, Necroptosis, Neutrophil extracellular trap formation, Alcoholism, Systemic lupus erythematosus, Ub-specific processing proteases, HCMV Late Events, HCMV Early Events, RMTs methylate histone arginines, UCH proteinases, Metalloprotease DUBs, HDACs deacetylate histones +1 more Related via 13 shared pathways including ATP-dependent chromatin remodeling, Necroptosis. H2AC16 13 shared pathwaysATP-dependent chromatin remodeling, Necroptosis, Neutrophil extracellular trap formation, Alcoholism, Systemic lupus erythematosus, Ub-specific processing proteases, HCMV Late Events, HCMV Early Events, RMTs methylate histone arginines, UCH proteinases, Metalloprotease DUBs, HDACs deacetylate histones +1 more Related via 13 shared pathways including ATP-dependent chromatin remodeling, Necroptosis.
Major depressive disorder Linked via 2 of 5 related genesH2AC1, H2AC15 Breast cancer Linked via 1 of 5 related genesH2AC1 Coronary artery disease Linked via 1 of 5 related genesH2AC1 Neurotic disorder Linked via 1 of 5 related genesH2AC1 Bipolar disorder Linked via 1 of 5 related genesH2AC15