Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3024
Gene name	H1.1 linker histone, cluster member
Gene symbol	H1-1
Synonyms (NCBI Gene)	H1.1H1AH1F1HIST1HIST1H1A
Chromosome	6
Chromosome location	6p22.2
Summary	Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in

26 Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	19882353
GO:0000785	Component	Chromatin	IEA
GO:0000786	Component	Nucleosome	IEA
GO:0000791	Component	Euchromatin	IBA
GO:0000791	Component	Euchromatin	IDA	15911621
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IBA
GO:0005515	Function	Protein binding	IPI	19895577, 28514442, 30021884, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0006334	Process	Nucleosome assembly	IEA
GO:0007283	Process	Spermatogenesis	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	TAS	7989039
GO:0008201	Function	Heparin binding	IEA
GO:0009986	Component	Cell surface	IEA
GO:0030261	Process	Chromosome condensation	IBA
GO:0030527	Function	Structural constituent of chromatin	IEA
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0031490	Function	Chromatin DNA binding	IMP	15911621
GO:0031492	Function	Nucleosomal DNA binding	IBA
GO:0031982	Component	Vesicle	IEA
GO:0045910	Process	Negative regulation of DNA recombination	IBA
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	IEA

MIM	HGNC	e!Ensembl
142709	4715	ENSG00000124610

Q02539

Protein name

Histone H1.1 (Histone H1a)

Protein function

Histone H1 protein binds to linker DNA between nucleosomes forming the macromolecular structure known as the chromatin fiber. Histones H1 are necessary for the condensation of nucleosome chains into higher-order structured fibers. Also acts as a

PDB

9J8O

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00538	Linker_histone	40 → 111	linker histone H1 and H5 family	Domain

Sequence

MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGV
SLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETK
PGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKV
AKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK

Sequence length

215

Interactions

View interactions

Reactome Pathway
Apoptosis induced DNA fragmentation
Formation of Senescence-Associated Heterochromatin Foci (SAHF)

H1-1 (H1.1 linker histone, cluster member)

Bookmark This Gene