GSTA1 (glutathione S-transferase alpha 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 2938
Gene name Glutathione S-transferase alpha 1
Gene symbol GSTA1
Synonyms (NCBI Gene)
GST-epsilonGST2GSTA1-1GTH1
Chromosome 6
Chromosome location 6p12.2
Summary This gene encodes a member of a family of enzymes that function to add glutathione to target electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. This action is an important step in det
miRNA miRNA information provided by mirtarbase database.
21 Show/Hide all (21)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT029138 hsa-miR-26b-5p Microarray 19088304
MIRT1036467 hsa-miR-4269 CLIP-seq
MIRT1036468 hsa-miR-4757-5p CLIP-seq
MIRT1036469 hsa-miR-488 CLIP-seq
MIRT1036470 hsa-miR-513b CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Download as csvDownload as pdf
Transcription factor Regulation Reference
NFE2L2 Activation 16551619
NFE2L2 Repression 22459801
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27 Show/Hide all (27)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004364 Function Glutathione transferase activity IBA
GO:0004364 Function Glutathione transferase activity IDA 9084911, 11851347, 20606271
GO:0004364 Function Glutathione transferase activity IEA
GO:0004364 Function Glutathione transferase activity NAS 1731620
GO:0004601 Function Peroxidase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
138359 4626 ENSG00000243955
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P08263
Protein name Glutathione S-transferase A1 (EC 2.5.1.18) (13-hydroperoxyoctadecadienoate peroxidase) (EC 1.11.1.-) (Androst-5-ene-3,17-dione isomerase) (EC 5.3.3.-) (GST HA subunit 1) (GST class-alpha member 1) (GST-epsilon) (GSTA1-1) (GTH1) [Cleaved into: Glutathione
Protein function Glutathione S-transferase that catalyzes the nucleophilic attack of the sulfur atom of glutathione on the electrophilic groups of a wide range of exogenous and endogenous compounds (Probable). Involved in the formation of glutathione conjugates
PDB 1GSD , 1GSE , 1GSF , 1GUH , 1K3L , 1K3O , 1K3Y , 1LBK , 1PKW , 1PKZ , 1PL1 , 1PL2 , 1USB , 1XWG , 1YDK , 2R3X , 2R6K , 3I69 , 3I6A , 3IK9 , 3KTL , 3L0H , 3Q74 , 3U6V , 3ZFB , 3ZFL , 4HJ2 , 5JCU , 5LCZ , 5LD0 , 6ATO , 6ATP , 6ATQ , 6ATR , 6YAW , 7BIB , 7BIC , 8BHC , 8BHE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00043 GST_C 99 → 192 Glutathione S-transferase, C-terminal domain Domain
PF02798 GST_N 5 → 77 Glutathione S-transferase, N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Liver.
Sequence 
MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAK
LALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF
Sequence length 222
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Glutathione metabolism Glutathione conjugation
Metabolism of xenobiotics by cytochrome P450 Heme degradation
Drug metabolism - cytochrome P450  
Drug metabolism - other enzymes  
Metabolic pathways  
Platinum drug resistance  
Pathways in cancer  
Chemical carcinogenesis - DNA adducts  
Chemical carcinogenesis - receptor activation  
Chemical carcinogenesis - reactive oxygen species  
Hepatocellular carcinoma  
Fluid shear stress and atherosclerosis  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
8
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (8)
Phenotype Name Clinical Significance Source Reference Evidence Score
ASTHMA — Disgenet —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE — Disgenet —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA — CTD, Disgenet
CTD, Disgenet 		16214533
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE — CTD, Disgenet
CTD, Disgenet 		23643483
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS — Disgenet —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (116)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Kidney Insufficiency Acute Kidney Insufficiency CTD_human_DG 28885000
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 11550208
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma LHGDN 11550208, 12447480
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 11297599
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenoma of large intestine Colorectal adenoma BEFREE 16365014
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 24245549
★★★★★
★☆☆☆☆
Found in Text Mining only
Adrenal Cortical Adenoma Adrenocortical adenoma BEFREE 11297599
★★★★★
★☆☆☆☆
Found in Text Mining only
Adrenoleukodystrophy Adrenoleukodystrophy BEFREE 15525789
★★★★★
★☆☆☆☆
Found in Text Mining only
Adult Hodgkin Lymphoma Hodgkin Lymphoma BEFREE 22475179
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 37925455 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
GSTM2 1 shared diseaseKidney failure 11 shared pathwaysGlutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Platinum drug resistance, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation, Chemical carcinogenesis - reactive oxygen species, Hepatocellular carcinoma, Fluid shear stress and atherosclerosis, Glutathione conjugation 2 shared evidence sourcesDisgenet (Kidney failure), CTD (Myocardial ischemia) Related via 11 shared pathways including Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 — evidence mostly Disgenet. GSTT1 1 shared diseaseKidney failure 11 shared pathwaysGlutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Platinum drug resistance, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation, Chemical carcinogenesis - reactive oxygen species, Hepatocellular carcinoma, Fluid shear stress and atherosclerosis, Glutathione conjugation 4 shared evidence sourcesDisgenet (Asthma), Disgenet (Kidney failure), CTD (Nonalcoholic fatty liver disease), Disgenet (Nonalcoholic fatty liver disease) Related via 11 shared pathways including Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 — evidence mostly Disgenet. GSTM1 1 shared diseaseKidney failure 11 shared pathwaysGlutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Platinum drug resistance, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation, Chemical carcinogenesis - reactive oxygen species, Hepatocellular carcinoma, Fluid shear stress and atherosclerosis, Glutathione conjugation 4 shared evidence sourcesDisgenet (Asthma), Disgenet (Kidney failure), CTD (Nonalcoholic fatty liver disease), Disgenet (Nonalcoholic fatty liver disease) Related via 11 shared pathways including Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 — evidence mostly Disgenet. CYP2B6 2 shared diseasesKidney failure, Psychotic disorders 3 shared pathwaysMetabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Chemical carcinogenesis - receptor activation 2 shared evidence sourcesDisgenet (Kidney failure), Disgenet (Psychotic disorders) Related via 3 shared pathways including Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450 — evidence mostly Disgenet. GSTA5 11 shared pathwaysGlutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Platinum drug resistance, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation, Chemical carcinogenesis - reactive oxygen species, Hepatocellular carcinoma, Fluid shear stress and atherosclerosis, Glutathione conjugation Related via 11 shared pathways including Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450.
Breast cancer Linked via 2 of 5 related genesGSTM2, GSTM1 Degenerative disorder Linked via 2 of 5 related genesGSTM2, GSTM1 Neurodegenerative disorder Linked via 2 of 5 related genesGSTM2, GSTM1 Willis-ekbom disease Linked via 2 of 5 related genesGSTM2, GSTM1 Amphetamine or sympathomimetic abuse Linked via 2 of 5 related genesGSTT1, GSTM1