GNRH2 (gonadotropin releasing hormone 2)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 2797
Gene name Gonadotropin releasing hormone 2
Gene symbol GNRH2
Synonyms (NCBI Gene)
GnRH-IILH-RHII
Chromosome 20
Chromosome location 20p13
Summary This gene is a member of the gonadotropin-releasing hormone (GnRH) gene family. Proteins encoded by members of this gene family are proteolytically cleaved to form neuropeptides which, in part, regulate reproductive functions by stimulating the production
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Download as csvDownload as pdf
Transcription factor Regulation Reference
RARA Unknown 17451432
RELA Repression 17451432
RXRA Unknown 17451432
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005179 Function Hormone activity IEA
GO:0005179 Function Hormone activity TAS 9419371
GO:0005183 Function Gonadotropin hormone-releasing hormone activity IBA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
602352 4420 ENSG00000125787
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43555
Protein name Progonadoliberin-2 (Progonadoliberin II) [Cleaved into: Gonadoliberin-2 (Gonadoliberin II) (Gonadotropin-releasing hormone II) (GnRH II) (Luliberin II) (Luteinizing hormone-releasing hormone II) (LH-RH II); GnRH-associated peptide 2 (GnRH-associated pepti
Protein function Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00446 GnRH 24 → 33 Gonadotropin-releasing hormone Family
Tissue specificity TISSUE SPECIFICITY: Midbrain; expressed at significantly higher levels outside the brain (up to 30-fold), particularly in the kidney, bone marrow and prostate.
Sequence 
MASSRRGLLLLLLLTAHLGPSEAQHWSHGWYPGGKRALSSAQDPQNALRPPGRALDTAAG
SPVQTAHGLPSDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV
Sequence length 120
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Neuroactive ligand-receptor interaction Hormone ligand-binding receptors
Hormone signaling G alpha (q) signalling events
GnRH signaling pathway  
GnRH secretion  
Sort by:
GNRH1 5 shared pathwaysHormone signaling, GnRH signaling pathway, GnRH secretion, G alpha (q) signalling events, Hormone ligand-binding receptors Related via 5 shared pathways including Hormone signaling, GnRH signaling pathway. GNRHR 4 shared pathwaysHormone signaling, GnRH signaling pathway, G alpha (q) signalling events, Hormone ligand-binding receptors Related via 4 shared pathways including Hormone signaling, GnRH signaling pathway. MLNR 2 shared pathwaysHormone signaling, G alpha (q) signalling events Related via 2 shared pathways including Hormone signaling, G alpha (q) signalling events. HCRT 2 shared pathwaysHormone signaling, G alpha (q) signalling events Related via 2 shared pathways including Hormone signaling, G alpha (q) signalling events. HCRTR1 2 shared pathwaysHormone signaling, G alpha (q) signalling events Related via 2 shared pathways including Hormone signaling, G alpha (q) signalling events.
Hypogonadism Linked via 2 of 5 related genesGNRH1, GNRHR Hypogonadotropic hypogonadism Linked via 2 of 5 related genesGNRH1, GNRHR Hypopituitarism Linked via 2 of 5 related genesGNRH1, GNRHR Growth hormone deficiency Linked via 2 of 5 related genesGNRH1, GNRHR Kallmann syndrome Linked via 2 of 5 related genesGNRH1, GNRHR