GNG11 (G protein subunit gamma 11)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2791
• Gene name: G protein subunit gamma 11
• Gene symbol: GNG11
• Synonyms (NCBI Gene): GNGT11, HG3H1
• Chromosome: 7
• Chromosome location: 7q21.3
• Summary: This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling sy

miRNA Show/Hide all (67)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2236514	hsa-miR-127-5p	CLIP-seq
MIRT2236515	hsa-miR-3942-5p	CLIP-seq
MIRT2236516	hsa-miR-4703-5p	CLIP-seq
MIRT2540245	hsa-miR-1265	CLIP-seq
MIRT2540246	hsa-miR-1298	CLIP-seq
MIRT2540247	hsa-miR-150	CLIP-seq
MIRT2540248	hsa-miR-153	CLIP-seq
MIRT2540249	hsa-miR-217	CLIP-seq
MIRT2540250	hsa-miR-2392	CLIP-seq
MIRT2540251	hsa-miR-3126-3p	CLIP-seq
MIRT2540252	hsa-miR-3140-3p	CLIP-seq
MIRT2540253	hsa-miR-3168	CLIP-seq
MIRT2540254	hsa-miR-3174	CLIP-seq
MIRT2540255	hsa-miR-3192	CLIP-seq
MIRT2540256	hsa-miR-3653	CLIP-seq
MIRT2540257	hsa-miR-3658	CLIP-seq
MIRT2540258	hsa-miR-3667-3p	CLIP-seq
MIRT2540259	hsa-miR-3907	CLIP-seq
MIRT2540260	hsa-miR-4314	CLIP-seq
MIRT2540261	hsa-miR-4422	CLIP-seq
MIRT2540262	hsa-miR-4436b-5p	CLIP-seq
MIRT2540263	hsa-miR-4646-5p	CLIP-seq
MIRT2540264	hsa-miR-4713-5p	CLIP-seq
MIRT2540265	hsa-miR-4720-3p	CLIP-seq
MIRT2540266	hsa-miR-4775	CLIP-seq
MIRT2540267	hsa-miR-4781-3p	CLIP-seq
MIRT2540268	hsa-miR-4789-5p	CLIP-seq
MIRT2540269	hsa-miR-4804-3p	CLIP-seq
MIRT2540270	hsa-miR-495	CLIP-seq
MIRT2540271	hsa-miR-532-3p	CLIP-seq
MIRT2540272	hsa-miR-548u	CLIP-seq
MIRT2540273	hsa-miR-651	CLIP-seq
MIRT2540274	hsa-miR-767-3p	CLIP-seq
MIRT2540275	hsa-miR-921	CLIP-seq
MIRT2540245	hsa-miR-1265	CLIP-seq
MIRT2540246	hsa-miR-1298	CLIP-seq
MIRT2540247	hsa-miR-150	CLIP-seq
MIRT2540248	hsa-miR-153	CLIP-seq
MIRT2540249	hsa-miR-217	CLIP-seq
MIRT2540250	hsa-miR-2392	CLIP-seq
MIRT2540251	hsa-miR-3126-3p	CLIP-seq
MIRT2540252	hsa-miR-3140-3p	CLIP-seq
MIRT2681741	hsa-miR-3153	CLIP-seq
MIRT2540253	hsa-miR-3168	CLIP-seq
MIRT2540254	hsa-miR-3174	CLIP-seq
MIRT2540255	hsa-miR-3192	CLIP-seq
MIRT2540256	hsa-miR-3653	CLIP-seq
MIRT2540257	hsa-miR-3658	CLIP-seq
MIRT2540258	hsa-miR-3667-3p	CLIP-seq
MIRT2540259	hsa-miR-3907	CLIP-seq
MIRT2540260	hsa-miR-4314	CLIP-seq
MIRT2540261	hsa-miR-4422	CLIP-seq
MIRT2540262	hsa-miR-4436b-5p	CLIP-seq
MIRT2540263	hsa-miR-4646-5p	CLIP-seq
MIRT2681742	hsa-miR-4668-5p	CLIP-seq
MIRT2540264	hsa-miR-4713-5p	CLIP-seq
MIRT2540265	hsa-miR-4720-3p	CLIP-seq
MIRT2540266	hsa-miR-4775	CLIP-seq
MIRT2540267	hsa-miR-4781-3p	CLIP-seq
MIRT2540268	hsa-miR-4789-5p	CLIP-seq
MIRT2540269	hsa-miR-4804-3p	CLIP-seq
MIRT2540270	hsa-miR-495	CLIP-seq
MIRT2540271	hsa-miR-532-3p	CLIP-seq
MIRT2540272	hsa-miR-548u	CLIP-seq
MIRT2540273	hsa-miR-651	CLIP-seq
MIRT2540274	hsa-miR-767-3p	CLIP-seq
MIRT2540275	hsa-miR-921	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	TAS	7665596
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005834	Component	Heterotrimeric G-protein complex	IBA
GO:0005834	Component	Heterotrimeric G-protein complex	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	7665596
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0031681	Function	G-protein beta-subunit binding	IBA
GO:0031681	Function	G-protein beta-subunit binding	IEA

Other IDs

• MIM: 604390
• HGNC: 4403
• e!Ensembl: ENSG00000127920

Protein

• UniProt ID: P61952
• Protein name: Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
• Protein function: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G prote
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00631	G-gamma	9 → 73	GGL domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Abundantly expressed in all tissues tested except for brain.
• Sequence:

  MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED
  KNPFKEKGSCVIS

• Sequence length: 73

Pathways

KEGG Pathway	Reactome Pathway
Ras signaling pathway	Activation of G protein gated Potassium channels
Chemokine signaling pathway	Glucagon signaling in metabolic regulation
Hormone signaling	G-protein activation
PI3K-Akt signaling pathway	Glucagon-like Peptide-1 (GLP1) regulates insulin secretion
Apelin signaling pathway	ADP signalling through P2Y purinoceptor 12
Circadian entrainment	G beta:gamma signalling through PI3Kgamma
Retrograde endocannabinoid signaling	Prostacyclin signalling through prostacyclin receptor
Glutamatergic synapse	Adrenaline,noradrenaline inhibits insulin secretion
Cholinergic synapse	Ca2+ pathway
Serotonergic synapse	G alpha (q) signalling events
GABAergic synapse	G alpha (12/13) signalling events
Dopaminergic synapse	G beta:gamma signalling through PLC beta
Relaxin signaling pathway	G alpha (s) signalling events
Morphine addiction	ADP signalling through P2Y purinoceptor 1
Alcoholism	G alpha (i) signalling events
Human cytomegalovirus infection	G alpha (z) signalling events
Kaposi sarcoma-associated herpesvirus infection	Glucagon-type ligand receptors
Human immunodeficiency virus 1 infection	Thromboxane signalling through TP receptor
Pathways in cancer	Vasopressin regulates renal water homeostasis via Aquaporins
	Thrombin signalling through proteinase activated receptors (PARs)
	Presynaptic function of Kainate receptors
	Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
	G beta:gamma signalling through BTK
	G beta:gamma signalling through CDC42
	Extra-nuclear estrogen signaling
	ADORA2B mediated anti-inflammatory cytokines production
	Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (8)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ARTHRITIS, JUVENILE	—	CTD	19565504	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (19)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	20670477		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	24366584		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	21829388	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	31258663		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	35370940	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22706224	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	34861820	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20670477	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20670477	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20670477		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35120576	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35342758	Associate	★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	20670477		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31258663		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ACP3 3 shared diseasesJuvenile arthritis, Juvenile idiopathic arthritis, Oligoarticular juvenile idiopathic arthritis 3 shared evidence sourcesCTD (Juvenile arthritis), Disgenet (Juvenile idiopathic arthritis), Disgenet (Oligoarticular juvenile idiopathic arthritis) Related via 3 shared diseases including Juvenile arthritis, Juvenile idiopathic arthritis — evidence mostly Disgenet. ACRBP 3 shared diseasesJuvenile arthritis, Juvenile idiopathic arthritis, Oligoarticular juvenile idiopathic arthritis 3 shared evidence sourcesCTD (Juvenile arthritis), Disgenet (Juvenile idiopathic arthritis), Disgenet (Oligoarticular juvenile idiopathic arthritis) Related via 3 shared diseases including Juvenile arthritis, Juvenile idiopathic arthritis — evidence mostly Disgenet. ANKRD9 3 shared diseasesJuvenile arthritis, Juvenile idiopathic arthritis, Oligoarticular juvenile idiopathic arthritis 3 shared evidence sourcesCTD (Juvenile arthritis), Disgenet (Juvenile idiopathic arthritis), Disgenet (Oligoarticular juvenile idiopathic arthritis) Related via 3 shared diseases including Juvenile arthritis, Juvenile idiopathic arthritis — evidence mostly Disgenet. AVL9 3 shared diseasesJuvenile arthritis, Juvenile idiopathic arthritis, Oligoarticular juvenile idiopathic arthritis 3 shared evidence sourcesCTD (Juvenile arthritis), Disgenet (Juvenile idiopathic arthritis), Disgenet (Oligoarticular juvenile idiopathic arthritis) Related via 3 shared diseases including Juvenile arthritis, Juvenile idiopathic arthritis — evidence mostly Disgenet. B4GALT5 3 shared diseasesJuvenile arthritis, Juvenile idiopathic arthritis, Oligoarticular juvenile idiopathic arthritis 3 shared evidence sourcesCTD (Juvenile arthritis), Disgenet (Juvenile idiopathic arthritis), Disgenet (Oligoarticular juvenile idiopathic arthritis) Related via 3 shared diseases including Juvenile arthritis, Juvenile idiopathic arthritis — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ACP3	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	0	[]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
ACRBP	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	0	[]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
ANKRD9	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	0	[]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
AVL9	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	0	[]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
B4GALT5	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	0	[]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]

Diseases Linked via Similar Genes

Prostatic neoplasms Linked via 1 of 5 related genesACRBP Alzheimer disease Linked via 1 of 5 related genesAVL9 Insomnia Linked via 1 of 5 related genesAVL9

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Prostatic neoplasms	1	["ACRBP"]
Alzheimer disease	1	["AVL9"]
Insomnia	1	["AVL9"]