GNA15 (G protein subunit alpha 15)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2769
• Gene name: G protein subunit alpha 15
• Gene symbol: GNA15
• Synonyms (NCBI Gene): GNA16, HG1L
• Chromosome: 19
• Chromosome location: 19p13.3

miRNA Show/Hide all (21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1023153	hsa-miR-1184	CLIP-seq
MIRT1023154	hsa-miR-3117-5p	CLIP-seq
MIRT1023155	hsa-miR-4691-3p	CLIP-seq
MIRT1023156	hsa-miR-4704-5p	CLIP-seq
MIRT1023157	hsa-miR-615-5p	CLIP-seq
MIRT2003432	hsa-miR-3173-3p	CLIP-seq
MIRT2003433	hsa-miR-4265	CLIP-seq
MIRT2003434	hsa-miR-4296	CLIP-seq
MIRT2003435	hsa-miR-4322	CLIP-seq
MIRT2003436	hsa-miR-4417	CLIP-seq
MIRT2003437	hsa-miR-4645-3p	CLIP-seq
MIRT2003438	hsa-miR-4738-3p	CLIP-seq
MIRT2003439	hsa-miR-4779	CLIP-seq
MIRT2003440	hsa-miR-542-3p	CLIP-seq
MIRT2236283	hsa-miR-1197	CLIP-seq
MIRT2236284	hsa-miR-1286	CLIP-seq
MIRT2236285	hsa-miR-3180-5p	CLIP-seq
MIRT2236286	hsa-miR-4436a	CLIP-seq
MIRT2003437	hsa-miR-4645-3p	CLIP-seq
MIRT2236287	hsa-miR-4738-5p	CLIP-seq
MIRT2003440	hsa-miR-542-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001664	Function	G protein-coupled receptor binding	IDA	10571060
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	7797501
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	TAS
GO:0005834	Component	Heterotrimeric G-protein complex	NAS	10571060
GO:0005886	Component	Plasma membrane	TAS	7797501, 8415674
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007207	Process	Phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway	TAS	7797501
GO:0019001	Function	Guanyl nucleotide binding	IEA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0019722	Process	Calcium-mediated signaling	IPI	10571060
GO:0031683	Function	G-protein beta/gamma-subunit complex binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 139314
• HGNC: 4383
• e!Ensembl: ENSG00000060558

Protein

• UniProt ID: P30679
• Protein name: Guanine nucleotide-binding protein subunit alpha-15 (G alpha-15) (G-protein subunit alpha-15) (Epididymis tissue protein Li 17E) (Guanine nucleotide-binding protein subunit alpha-16) (G alpha-16) (G-protein subunit alpha-16)
• Protein function: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00503	G-alpha	22 → 363	G-protein alpha subunit	Domain

• Tissue specificity: TISSUE SPECIFICITY: Specifically expressed in hematopoietic cells. Expressed in epididymis (at protein level). {ECO:0000269|PubMed:20736409}.
• Sequence:

  MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIK
  QMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQD
  PYKVTTFEKRYAAAMQWLWRDAGIRAYYERRREFHLLDSAVYYLSHLERITEEGYVPTAQ
  DVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQ
  CLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQG
  PKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVR
  DSVLARYLDEINLL

• Sequence length: 374

Pathways

KEGG Pathway	Reactome Pathway
Calcium signaling pathway	Acetylcholine regulates insulin secretion
Hormone signaling	G alpha (q) signalling events
Relaxin signaling pathway	ADP signalling through P2Y purinoceptor 1
Chagas disease	Thromboxane signalling through TP receptor
Amoebiasis	Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion
	Thrombin signalling through proteinase activated receptors (PARs)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTHMA	—	GWAS catalog	31959851, 32296059, 34103634	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	31669095	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	20445134	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	30595370, 38965376	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (20)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	7703490, 8683989		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	7703490		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	34290274	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34290274	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34290274	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33960436	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32066683	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21760593		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10861809	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	7703490		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23200847		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	32066683	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25701539		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	25701539		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24204697		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29170526, 39991148	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23200847		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34290274	Associate	★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	7703490		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

GNA14 10 shared pathwaysCalcium signaling pathway, Hormone signaling, Chagas disease, Amoebiasis, G alpha (q) signalling events, Thromboxane signalling through TP receptor, Thrombin signalling through proteinase activated receptors (PARs), ADP signalling through P2Y purinoceptor 1, Acetylcholine regulates insulin secretion, Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion Related via 10 shared pathways including Calcium signaling pathway, Hormone signaling. ILRUN 1 shared diseaseRespiratory system disease 2 shared evidence sourcesGWAS catalog (Heart failure), GWAS catalog (Respiratory system disease) Related via 1 shared disease including Respiratory system disease — evidence mostly GWAS catalog. NFATC2 2 shared diseasesCardiomyopathy, Respiratory system disease 1 shared pathwayCalcium signaling pathway 1 shared evidence sourceGWAS catalog (Respiratory system disease) Related via 2 shared diseases including Cardiomyopathy, Respiratory system disease — evidence mostly GWAS catalog. CAND2 1 shared diseaseCardiomyopathy 2 shared evidence sourcesGWAS catalog (Cardiomyopathy), GWAS catalog (Heart failure) Related via 1 shared disease including Cardiomyopathy — evidence mostly GWAS catalog. LSM3 1 shared diseaseCardiomyopathy 2 shared evidence sourcesGWAS catalog (Cardiomyopathy), GWAS catalog (Heart failure) Related via 1 shared disease including Cardiomyopathy — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GNA14	0	[]	10	["Calcium signaling pathway","Hormone signaling","Chagas disease","Amoebiasis","G alpha (q) signalling events","Thromboxane signalling through TP receptor","Thrombin signalling through proteinase activated receptors (PARs)","ADP signalling through P2Y purinoceptor 1","Acetylcholine regulates insulin secretion","Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion"]	0	[]
ILRUN	1	["Respiratory system disease"]	0	[]	2	["GWAS catalog (Heart failure)","GWAS catalog (Respiratory system disease)"]
NFATC2	2	["Cardiomyopathy","Respiratory system disease"]	1	["Calcium signaling pathway"]	1	["GWAS catalog (Respiratory system disease)"]
CAND2	1	["Cardiomyopathy"]	0	[]	2	["GWAS catalog (Cardiomyopathy)","GWAS catalog (Heart failure)"]
LSM3	1	["Cardiomyopathy"]	0	[]	2	["GWAS catalog (Cardiomyopathy)","GWAS catalog (Heart failure)"]

Diseases Linked via Similar Genes

Diabetes mellitus type 2 Linked via 3 of 5 related genesILRUN, NFATC2, CAND2 Bipolar disorder Linked via 2 of 5 related genesGNA14, ILRUN Scoliosis Linked via 2 of 5 related genesGNA14, NFATC2 Alzheimer disease Linked via 2 of 5 related genesILRUN, NFATC2 Hypertension Linked via 2 of 5 related genesILRUN, NFATC2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Diabetes mellitus type 2	3	["ILRUN","NFATC2","CAND2"]
Bipolar disorder	2	["GNA14","ILRUN"]
Scoliosis	2	["GNA14","NFATC2"]
Alzheimer disease	2	["ILRUN","NFATC2"]
Hypertension	2	["ILRUN","NFATC2"]