GGA1 (golgi associated, gamma adaptin ear containing, ARF binding protein 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 26088
• Gene name: Golgi associated, gamma adaptin ear containing, ARF binding protein 1
• Gene symbol: GGA1
• Synonyms (NCBI Gene): -
• Chromosome: 22
• Chromosome location: 22q13.1
• Summary: This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) protein family. Members of this family are ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysoso

miRNA Show/Hide all (66)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044423	hsa-miR-320a	CLASH	23622248
MIRT723074	hsa-miR-3127-3p	HITS-CLIP	19536157
MIRT723073	hsa-miR-6756-3p	HITS-CLIP	19536157
MIRT723072	hsa-miR-3183	HITS-CLIP	19536157
MIRT723071	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT723070	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT723069	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT723068	hsa-miR-1913	HITS-CLIP	19536157
MIRT723067	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT723066	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT723065	hsa-miR-210-5p	HITS-CLIP	19536157
MIRT723064	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT723063	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT723062	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT440574	hsa-miR-136-5p	HITS-CLIP	24374217
MIRT440574	hsa-miR-136-5p	HITS-CLIP	24374217
MIRT723074	hsa-miR-3127-3p	HITS-CLIP	19536157
MIRT723073	hsa-miR-6756-3p	HITS-CLIP	19536157
MIRT723072	hsa-miR-3183	HITS-CLIP	19536157
MIRT723071	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT723070	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT723069	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT723068	hsa-miR-1913	HITS-CLIP	19536157
MIRT723067	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT723066	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT723065	hsa-miR-210-5p	HITS-CLIP	19536157
MIRT723064	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT723063	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT723062	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT1017650	hsa-miR-1193	CLIP-seq
MIRT1017651	hsa-miR-1470	CLIP-seq
MIRT1017652	hsa-miR-3134	CLIP-seq
MIRT1017653	hsa-miR-3652	CLIP-seq
MIRT1017654	hsa-miR-4430	CLIP-seq
MIRT1017655	hsa-miR-4469	CLIP-seq
MIRT1017656	hsa-miR-4520a-3p	CLIP-seq
MIRT1017657	hsa-miR-4645-5p	CLIP-seq
MIRT1017658	hsa-miR-4667-3p	CLIP-seq
MIRT1017659	hsa-miR-4673	CLIP-seq
MIRT1017660	hsa-miR-105	CLIP-seq
MIRT1017661	hsa-miR-1343	CLIP-seq
MIRT1017662	hsa-miR-198	CLIP-seq
MIRT1017663	hsa-miR-221	CLIP-seq
MIRT1017664	hsa-miR-222	CLIP-seq
MIRT1017665	hsa-miR-3671	CLIP-seq
MIRT1017666	hsa-miR-516b	CLIP-seq
MIRT1017667	hsa-miR-607	CLIP-seq
MIRT1017668	hsa-miR-622	CLIP-seq
MIRT2001428	hsa-miR-766	CLIP-seq
MIRT2234465	hsa-miR-103b	CLIP-seq
MIRT1017650	hsa-miR-1193	CLIP-seq
MIRT2538579	hsa-miR-2467-3p	CLIP-seq
MIRT1017652	hsa-miR-3134	CLIP-seq
MIRT2538580	hsa-miR-3617	CLIP-seq
MIRT2538581	hsa-miR-4256	CLIP-seq
MIRT2538582	hsa-miR-4266	CLIP-seq
MIRT2538583	hsa-miR-4286	CLIP-seq
MIRT1017656	hsa-miR-4520a-3p	CLIP-seq
MIRT2538584	hsa-miR-4530	CLIP-seq
MIRT2538585	hsa-miR-4695-5p	CLIP-seq
MIRT2538586	hsa-miR-4779	CLIP-seq
MIRT2538587	hsa-miR-641	CLIP-seq
MIRT2538588	hsa-miR-922	CLIP-seq
MIRT2538582	hsa-miR-4266	CLIP-seq
MIRT2538585	hsa-miR-4695-5p	CLIP-seq
MIRT2538586	hsa-miR-4779	CLIP-seq

Gene ontology (GO) Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11387475, 11390366, 11821067, 12505986, 12767220, 14637142, 14638859, 15143060, 15231748, 15457209, 15466887, 15886016, 17855360, 18418388, 20676133, 22522702, 25416956, 26053850, 27901063, 28514442, 30679749, 32296183, 32814053, 33961781, 35156780, 36012204, 37219487, 39009827
GO:0005654	Component	Nucleoplasm	IDA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	15886016
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	TAS	20214818
GO:0005802	Component	Trans-Golgi network	IBA
GO:0005802	Component	Trans-Golgi network	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006886	Process	Intracellular protein transport	IDA	15886016
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006886	Process	Intracellular protein transport	TAS	20211637
GO:0006893	Process	Golgi to plasma membrane transport	IBA
GO:0006893	Process	Golgi to plasma membrane transport	IEA
GO:0008104	Process	Intracellular protein localization	IDA	15886016
GO:0010008	Component	Endosome membrane	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030163	Process	Protein catabolic process	IEA
GO:0031267	Function	Small GTPase binding	IBA
GO:0031267	Function	Small GTPase binding	IEA
GO:0031267	Function	Small GTPase binding	IPI	12668765, 12679809
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	TAS
GO:0032991	Component	Protein-containing complex	IMP	12668765, 12679809, 12767220
GO:0034394	Process	Protein localization to cell surface	IBA
GO:0034394	Process	Protein localization to cell surface	IDA	27901063
GO:0034394	Process	Protein localization to cell surface	IEA
GO:0035091	Function	Phosphatidylinositol binding	IEA
GO:0042147	Process	Retrograde transport, endosome to Golgi	IDA	15886016
GO:0043001	Process	Golgi to plasma membrane protein transport	IDA	27901063
GO:0043001	Process	Golgi to plasma membrane protein transport	IEA
GO:0043130	Function	Ubiquitin binding	IEA
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:1903441	Process	Protein localization to ciliary membrane	IEA

Other IDs

• MIM: 606004
• HGNC: 17842
• e!Ensembl: ENSG00000100083

Protein

• UniProt ID: Q9UJY5
• Protein name: ADP-ribosylation factor-binding protein GGA1 (Gamma-adaptin-related protein 1) (Golgi-localized, gamma ear-containing, ARF-binding protein 1)
• Protein function: Plays a role in protein sorting and trafficking between the trans-Golgi network (TGN) and endosomes. Mediates the ARF-dependent recruitment of clathrin to the TGN and binds ubiquitinated proteins and membrane cargo molecules with a cytosolic aci
• PDB: 1J2J , 1JWF , 1JWG , 1NA8 , 1NAF , 1NWM , 1O3X , 1OM9 , 1OXZ , 1PY1 , 1UJJ , 1UJK , 1X79 , 2DWX , 2DWY , 3G2S , 3G2T , 3G2U , 3G2V , 3G2W
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00790	VHS	5 → 143	VHS domain	Domain
  PF02883	Alpha_adaptinC2	513 → 631	Adaptin C-terminal domain	Domain
  PF03127	GAT	222 → 300	GAT domain	Domain
  PF18308	GGA_N-GAT	169 → 207	GGA N-GAT domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed.
• Sequence:

  MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQE
  WEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLY
  SWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDTTFPLPPPRPKNVIFEDEEKSKMLAR
  LLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGA
  AAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRG
  EEVNGDATAGSIPGSTSALLDLSGLDLPPAGTTYPAMPTRPGEQASPEQPSASVSLLDDE
  LMSLGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGL
  DDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVS
  PEPPRPPQQPVPTELSLASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDV
  LVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLAN
  PQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL

• Sequence length: 639

Pathways

KEGG Pathway	Reactome Pathway
Lysosome	TBC/RABGAPs
	Amyloid fiber formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Gastric cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34560403	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

GGA2 3 shared pathwaysLysosome, Amyloid fiber formation, TBC/RABGAPs Related via 3 shared pathways including Lysosome, Amyloid fiber formation. GGA3 3 shared pathwaysLysosome, Amyloid fiber formation, TBC/RABGAPs Related via 3 shared pathways including Lysosome, Amyloid fiber formation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GGA2	0	[]	3	["Lysosome","Amyloid fiber formation","TBC\/RABGAPs"]	0	[]
GGA3	0	[]	3	["Lysosome","Amyloid fiber formation","TBC\/RABGAPs"]	0	[]

Diseases Linked via Similar Genes

Nephrotic syndrome Linked via 1 of 2 related genesGGA3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Nephrotic syndrome	1	["GGA3"]