GALNT17 (polypeptide N-acetylgalactosaminyltransferase 17)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 64409
• Gene name: Polypeptide N-acetylgalactosaminyltransferase 17
• Gene symbol: GALNT17
• Synonyms (NCBI Gene): GALNACT17, GALNT16, GALNT20, GALNTL3, GalNAc-T17, GalNAc-T19, GalNAc-T5L, WBSCR17
• Chromosome: 7
• Chromosome location: 7q11.22
• Summary: This gene encodes an N-acetylgalactosaminyltransferase. This gene is located centromeric to the common deleted region in Williams-Beuren syndrome (WBS), a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. This prote

miRNA Show/Hide all (152)

miRTarBase ID	miRNA	Experiments	Reference
MIRT614216	hsa-miR-8485	HITS-CLIP	19536157
MIRT611192	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT611191	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT614216	hsa-miR-8485	HITS-CLIP	19536157
MIRT611192	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT611191	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT614216	hsa-miR-8485	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614216	hsa-miR-8485	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614216	hsa-miR-8485	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614216	hsa-miR-8485	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614216	hsa-miR-8485	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614216	hsa-miR-8485	HITS-CLIP	23824327
MIRT641066	hsa-miR-603	HITS-CLIP	23824327
MIRT641065	hsa-miR-5582-5p	HITS-CLIP	23824327
MIRT641064	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT641063	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT641062	hsa-miR-4269	HITS-CLIP	23824327
MIRT641061	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614216	hsa-miR-8485	HITS-CLIP	23824327
MIRT641066	hsa-miR-603	HITS-CLIP	23824327
MIRT641065	hsa-miR-5582-5p	HITS-CLIP	23824327
MIRT641064	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT641063	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT641062	hsa-miR-4269	HITS-CLIP	23824327
MIRT641061	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614216	hsa-miR-8485	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614216	hsa-miR-8485	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614216	hsa-miR-8485	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614216	hsa-miR-8485	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614216	hsa-miR-8485	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT611192	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611191	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611190	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT611189	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT611188	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT611187	hsa-miR-6727-3p	HITS-CLIP	23824327

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0004653	Function	Polypeptide N-acetylgalactosaminyltransferase activity	IBA
GO:0004653	Function	Polypeptide N-acetylgalactosaminyltransferase activity	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006486	Process	Protein glycosylation	IEA
GO:0006493	Process	Protein O-linked glycosylation	IBA
GO:0006493	Process	Protein O-linked glycosylation	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 615137
• HGNC: 16347
• e!Ensembl: ENSG00000185274

Protein

• UniProt ID: Q6IS24
• Protein name: Polypeptide N-acetylgalactosaminyltransferase 17 (EC 2.4.1.41) (Polypeptide GalNAc transferase-like protein 3) (GalNAc-T-like protein 3) (pp-GaNTase-like protein 3) (Protein-UDP acetylgalactosaminyltransferase-like protein 3) (UDP-GalNAc:polypeptide N-ace
• Protein function: May catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00535	Glycos_transf_2	155 → 341	Glycosyl transferase family 2	Family
  PF00652	Ricin_B_lectin	465 → 591	Ricin-type beta-trefoil lectin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in brain and heart. Weakly expressed in kidney, liver, lung and spleen. {ECO:0000269|PubMed:12073013}.
• Sequence:

  MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQ
  DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
  NSYLSEKISLDRSIPDYRPTKCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
  THLLKEIILVDDNSDEEELKVPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
  VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
  CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
  VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
  LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
  QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
  CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK

• Sequence length: 598

Pathways

KEGG Pathway	Reactome Pathway
Mucin type O-glycan biosynthesis	O-linked glycosylation of mucins
Other types of O-glycan biosynthesis
Metabolic pathways

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (10)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BRONCHOPNEUMONIA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	38584840	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	23377640, 30718454	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	31127053	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	26198764, 35396580, 39753749	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	35893037	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (10)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31286696		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31286696	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36038676	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31286696	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31286696		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

POC1B-GALNT4 3 shared pathwaysMucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis, O-linked glycosylation of mucins Related via 3 shared pathways including Mucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis. GALNT6 3 shared pathwaysMucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis, O-linked glycosylation of mucins Related via 3 shared pathways including Mucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis. GALNT5 3 shared pathwaysMucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis, O-linked glycosylation of mucins Related via 3 shared pathways including Mucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis. GALNT13 3 shared pathwaysMucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis, O-linked glycosylation of mucins Related via 3 shared pathways including Mucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis. GALNT15 3 shared pathwaysMucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis, O-linked glycosylation of mucins Related via 3 shared pathways including Mucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
POC1B-GALNT4	0	[]	3	["Mucin type O-glycan biosynthesis","Other types of O-glycan biosynthesis","O-linked glycosylation of mucins"]	0	[]
GALNT6	0	[]	3	["Mucin type O-glycan biosynthesis","Other types of O-glycan biosynthesis","O-linked glycosylation of mucins"]	0	[]
GALNT5	0	[]	3	["Mucin type O-glycan biosynthesis","Other types of O-glycan biosynthesis","O-linked glycosylation of mucins"]	0	[]
GALNT13	0	[]	3	["Mucin type O-glycan biosynthesis","Other types of O-glycan biosynthesis","O-linked glycosylation of mucins"]	0	[]
GALNT15	0	[]	3	["Mucin type O-glycan biosynthesis","Other types of O-glycan biosynthesis","O-linked glycosylation of mucins"]	0	[]

Diseases Linked via Similar Genes

Metabolic syndrome Linked via 2 of 5 related genesPOC1B-GALNT4, GALNT13 Alzheimer disease Linked via 2 of 5 related genesGALNT13, GALNT15 Cone-rod dystrophy Linked via 1 of 5 related genesPOC1B-GALNT4 Keratoconus Linked via 1 of 5 related genesGALNT6 Central nervous system cancer Linked via 1 of 5 related genesGALNT13

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Metabolic syndrome	2	["POC1B-GALNT4","GALNT13"]
Alzheimer disease	2	["GALNT13","GALNT15"]
Cone-rod dystrophy	1	["POC1B-GALNT4"]
Keratoconus	1	["GALNT6"]
Central nervous system cancer	1	["GALNT13"]