GAD2 (glutamate decarboxylase 2)

Gene

• Entrez ID: 2572
• Gene name: Glutamate decarboxylase 2
• Gene symbol: GAD2
• Synonyms (NCBI Gene): GAD65
• Chromosome: 10
• Chromosome location: 10p12.1
• Summary: This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A path

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0004351	Function	Glutamate decarboxylase activity	IBA
GO:0004351	Function	Glutamate decarboxylase activity	IEA
GO:0005515	Function	Protein binding	IPI	10671565, 25416956, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006540	Process	Gamma-aminobutyrate shunt	IBA
GO:0006540	Process	Gamma-aminobutyrate shunt	TAS	1549570
GO:0007268	Process	Chemical synaptic transmission	TAS	8954991
GO:0009449	Process	Gamma-aminobutyric acid biosynthetic process	IBA
GO:0016020	Component	Membrane	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0016830	Function	Carbon-carbon lyase activity	IEA
GO:0016831	Function	Carboxy-lyase activity	IEA
GO:0019752	Process	Carboxylic acid metabolic process	IEA
GO:0030170	Function	Pyridoxal phosphate binding	IEA
GO:0030424	Component	Axon	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0061202	Component	Clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane	TAS

Other IDs

• MIM: 138275
• HGNC: 4093
• e!Ensembl: ENSG00000136750

Protein

• UniProt ID: Q05329
• Protein name: Glutamate decarboxylase 2 (EC 4.1.1.15) (65 kDa glutamic acid decarboxylase) (GAD-65) (Glutamate decarboxylase 65 kDa isoform)
• Protein function: Catalyzes the production of GABA.
• PDB: 1ES0, 2OKK, 7LZ6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00282	Pyridoxal_deC	138 → 509	Pyridoxal-dependent decarboxylase conserved domain	Domain

• Sequence:

  MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
  SQPPRAAARKAACACDQKPCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQ
  YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
  QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
  PGGAISNMYAMMIARFKMFPEVKEKGMAALPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
  LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
  MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ
  MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEY
  LYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEY
  GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL

• Sequence length: 585

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, MAJOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Addison Disease	Addison`s Disease	BEFREE	12515289		★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	27993512		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	31832829		★☆☆☆☆ Found in Text Mining only
amyloidosis IX	Amyloidosis	Pubtator	26405069	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	19229853, 25106036, 28088111, 28528448, 28777828, 30482494, 30936840, 31222745		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	19229853, 23906988, 25106036, 28088111, 28528448, 28777828, 30185582, 30482494, 30936840, 31222745		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	35348614	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28229923		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	17235515, 19358307		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	21901839	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10634404, 11325898, 11683403, 12865069, 16990664, 17956579, 19188433, 19289270, 20350527, 22270037, 24058450, 24927554, 28063151, 28096222, 29353399, 29404673, 30801971, 31754749, 8314020, 9404444, 9707599, 9757911		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	35348614, 36621173	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	15560956		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	BEFREE	21226980		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25333703		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	21226980		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	27995404		★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	15571623	Associate	★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	8954991, 8985701		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28063151		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22552777		★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	8954991, 8985701		★☆☆☆☆ Found in Text Mining only
Congenital Hemidysplasia with Ichthyosiform Erythroderma and Limb Defects	Congenital hemidysplasia with ichthyosiform erythroderma and limb defects	Pubtator	34153873	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	10439311		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	16206514	Associate	★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	15560956		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	25106036, 28608287, 28777828, 30936840, 31222745, 31346339, 31443804		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	20227114	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10422732, 10593565, 11034389, 11121550, 11325898, 11409713, 11845225, 11879720, 12021103, 12364437, 12515288, 12515289, 15365614, 16390386, 16464953, 18040284, 19289270, 20350527, 20670115, 21270202, 22104260, 22270037, 22402866, 22446173, 22776074, 22957706, 23228173, 23235561, 23480181, 23780460, 24496311, 26001397, 26797873, 26854192, 27398945, 30416020, 31472399, 8039604, 8314020, 8423232, 8824714, 9028724, 9498628, 9707599, 9892508		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	10403912, 23841104, 25966064, 29236750, 31713011, 31769235, 34153873	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10422732, 10593565, 11034389, 11049787, 11121550, 11325898, 11409713, 11845225, 11879720, 12021094, 12021103, 12364437, 12515288, 12515289, 15365614, 16390386, 16464953, 18040284, 18328264, 19289270, 20350527, 20670115, 21270202, 22104260, 22270037, 22402866, 22446173, 22776074, 22957706, 23228173, 23235561, 23480181, 23780460, 24496311, 25681349, 26001397, 26797873, 26854192, 27398945, 30416020, 31472399, 31532493, 8039604, 8314020, 8423232, 8824714, 9028724, 9498628, 9707599, 9892508		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	14557453		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Congenital Autoimmune	Diabetes mellitus	Pubtator	35348614	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	10403912, 10594551, 11681491, 11905848, 11927616, 1370298, 14678267, 16206514, 18549445, 20374524, 21097569, 21490167, 22174945, 22385239, 22587593, 23349478, 23480181, 24601691, 24705406, 26405067, 26981545, 28941965, 29229565, 29236750, 29619531, 30710658, 30801971, 31713011, 31769235, 32754804, 34272582, 34747488, 34988229, 35392100, 37309552, 7519242, 8679901, 8734572, 9153283, 9208924	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	21270202	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20670115, 25966064, 29619531, 30352895	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10052685, 10382586, 10403912, 10422732, 10426275, 10439311, 10458326, 10588452, 10593565, 10594551, 10596966, 10792336, 11121550, 11134089, 11134126, 11163769, 11325898, 11409713, 11522662, 11681491, 11683403, 11869046, 11894970, 12021103, 12021135, 12107749, 12196483, 12364437, 12515288, 12515289, 12765988, 12865069, 14557453, 14578287, 15030523, 15056761, 15170642, 15365614, 16206515, 16390386, 16442659, 16990664, 17130554, 17130557, 17130560, 17315139, 17325256, 17479437, 17641683, 17947651, 17956579, 18184926, 18324484, 19120261, 19136037, 19188433, 20445565, 20670115, 20836749, 20858521, 21097569, 21244337, 21270202, 21395375, 21490167, 22069276, 22270037, 22384267, 22402866, 22446173, 22776074, 22957706, 23228173, 23685786, 23780460, 24335553, 24444005, 24891767, 24927554, 25405480, 25474415, 25576592, 26001397, 26405067, 26740600, 26854192, 27398945, 27807935, 27872147, 28028075, 28480759, 28509692, 28546444, 28941965, 29067979, 29254501, 29506985, 29636076, 30213185, 30264481, 30307543, 30327357, 30343467, 30352895, 30644700, 30710658, 30727763, 30733517, 30801971, 31009057, 31127057, 31167877, 31207885, 31612266, 31769235, 7519242, 7556984, 7821743, 8314020, 8370667, 8486775, 8552991, 8679901, 8689840, 8692821, 8816973, 8816975, 8882419, 8958223, 9048916, 9153283, 9208924, 9223318, 9237801, 9314633, 9368637, 9368643, 9404444, 9498628, 9642660, 9707599, 9840449, 9885897, 9892508		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	18487477		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	BEFREE	30327357		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10458326, 10634404, 11879720, 12663567, 18717976, 25966064, 28546444, 30352895, 30853448, 31367990, 31769235		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	10422732, 10634404, 11034389, 12021128, 12515288, 16263243, 17949947, 18455963, 20350527, 25681349, 26612761, 26797873, 31612266		★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	30327357		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	CTD_human_DG	21412422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysautonomia	Dysautonomia	BEFREE	29370977		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	31649008		★☆☆☆☆ Found in Text Mining only
Epilepsia Partialis Continua	Epilepsia Partialis Continua	BEFREE	31649008		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	15571623, 35348614	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27220336, 28234800, 29353399, 29433947, 29636076, 29905150, 30057567, 30343467, 31093879, 31240596, 31649008		★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	33986308, 35348614	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Generalized	Epilepsy	LHGDN	17167787		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	29253681		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	8954991, 8985701		★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Esophageal achalasia	Pubtator	30449890	Associate	★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	8954991, 8985701		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	16433722, 9027428, 9368637		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	16206515		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22103299		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	18371956	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29172730		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31532493		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	14691540, 18835948, 23780460		★☆☆☆☆ Found in Text Mining only
Involutional Depression	Involutional Depression	CTD_human_DG	15560956		★☆☆☆☆ Found in Text Mining only
Involutional paraphrenia	Involutional Paraphrenia	CTD_human_DG	15560956		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	8954991, 8985701		★☆☆☆☆ Found in Text Mining only
Juvenile Neuronal Ceroid Lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	12023984, 15571623, 17070688		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	19136037		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26001397		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34153873	Associate	★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	12021137, 20670115, 27913577, 31769235		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	20670115, 31769235, 35392100	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	CTD_human_DG	15560956		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	21226980, 26848839, 29549826		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25333703		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22072614		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28528448		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30048975, 31015081, 31443804, 31472399		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	12021135		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	15560956		★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	15560956		★☆☆☆☆ Found in Text Mining only
Maple Syrup Urine Disease	Maple syrup urine disease	Pubtator	25966064	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25106036, 28608287, 28777828, 30936840, 31222745, 31346339, 31443804		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	15671113		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	31291638		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	19229853, 26848839		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	19229853		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29964000		★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	18328264		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	24485154		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21955519, 22072614, 28245795, 31661704		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28063151, 31472399, 31532493		★☆☆☆☆ Found in Text Mining only
Neuronal Ceroid-Lipofuscinoses	Neuronal Ceroid Lipofuscinosis	LHGDN	18378887		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	19229853		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	27967329		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	14691540, 15671113, 16122350, 16220643, 16731858, 16741266, 18371956, 19686769		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	14691540, 16122350, 18371956, 22366823	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	14691540	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	14691540, 15671113, 16122350, 16220643, 16741266		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	24571444, 30351181		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22072614		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	23906988		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	12376704		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15829994		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	15829994		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	15671113		★☆☆☆☆ Found in Text Mining only
Precocious pubarche	Precocious Pubarche	BEFREE	18371956		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28528448		★☆☆☆☆ Found in Text Mining only
Psychomotor Disorders	Psychiatric disorders	Pubtator	20227114	Associate	★☆☆☆☆ Found in Text Mining only
Psychosis, Involutional	Psychosis	CTD_human_DG	15560956		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	27967329, 28573688		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	9699085		★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	24993056		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15114630, 17412563, 19125103, 21677653, 24993056, 26848839, 27733539, 28573688		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15114630, 17412563		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	15560956, 18923069		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Single Seizure	Seizure	CTD_human_DG	8954991, 8985701		★☆☆☆☆ Found in Text Mining only
SMALL PATELLA SYNDROME	SMALL PATELLA SYNDROME	BEFREE	28017232		★☆☆☆☆ Found in Text Mining only
Smith-Magenis syndrome	Smith-Magenis Syndrome	BEFREE	7519242, 9368637		★☆☆☆☆ Found in Text Mining only
Stiff-Person Syndrome	Stiff-Person Syndrome	LHGDN	12197888		★☆☆☆☆ Found in Text Mining only
Stiff-Person Syndrome	Stiff-Person Syndrome	BEFREE	14610143, 15571623, 21680149, 24058450, 28017232, 30192027, 30264481, 30343467, 30952585, 31015081, 31789305, 7519242, 9368637		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	12865069, 26405068		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	26405068	Associate	★☆☆☆☆ Found in Text Mining only
Thyrotoxicosis	Thyrotoxicosis	BEFREE	16206515		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	8954991, 8985701		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	19229853, 26848839, 29549826		★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	8954991, 8985701		★☆☆☆☆ Found in Text Mining only