GAD1 (glutamate decarboxylase 1)

Gene

• Entrez ID: 2571
• Gene name: Glutamate decarboxylase 1
• Gene symbol: GAD1
• Synonyms (NCBI Gene): CPSQ1, DEE89, GAD, SCP
• Chromosome: 2
• Chromosome location: 2q31.1
• Summary: This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A path

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121918345	C>G,T	Pathogenic	Genic upstream transcript variant, coding sequence variant, missense variant
rs774953382	C>G,T	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1575446166	T>G	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT756090	hsa-miR-24-3p	Luciferase reporter assay, Western blotting	36814556
MIRT1010176	hsa-miR-105	CLIP-seq
MIRT1010177	hsa-miR-1253	CLIP-seq
MIRT1010178	hsa-miR-1324	CLIP-seq
MIRT1010179	hsa-miR-2278	CLIP-seq
MIRT1010180	hsa-miR-24	CLIP-seq
MIRT1010181	hsa-miR-4284	CLIP-seq
MIRT1010182	hsa-miR-4468	CLIP-seq
MIRT1010183	hsa-miR-4645-3p	CLIP-seq
MIRT1010184	hsa-miR-4719	CLIP-seq
MIRT1010185	hsa-miR-4753-3p	CLIP-seq
MIRT1010186	hsa-miR-4768-5p	CLIP-seq
MIRT1010187	hsa-miR-600	CLIP-seq
MIRT1010188	hsa-miR-9	CLIP-seq
MIRT2536560	hsa-miR-3944-5p	CLIP-seq
MIRT2536561	hsa-miR-935	CLIP-seq
MIRT2536560	hsa-miR-3944-5p	CLIP-seq
MIRT2536561	hsa-miR-935	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ARNT	Unknown	18335162
DNMT1	Repression	19029285
HDAC1	Repression	19029285
MECP2	Repression	19029285
XBP1	Unknown	18335162

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004351	Function	Glutamate decarboxylase activity	IBA
GO:0004351	Function	Glutamate decarboxylase activity	IDA	10671565, 17384644
GO:0004351	Function	Glutamate decarboxylase activity	IEA
GO:0005515	Function	Protein binding	IPI	10671565, 16189514, 17474147, 21516116, 25416956, 26871637, 31515488, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005938	Component	Cell cortex	IEA
GO:0006538	Process	L-glutamate catabolic process	IDA	17384644
GO:0006538	Process	L-glutamate catabolic process	TAS	10671565
GO:0006540	Process	Gamma-aminobutyrate shunt	TAS	1549570
GO:0007268	Process	Chemical synaptic transmission	TAS	8954991
GO:0009449	Process	Gamma-aminobutyric acid biosynthetic process	IBA
GO:0009449	Process	Gamma-aminobutyric acid biosynthetic process	IDA	17384644
GO:0009449	Process	Gamma-aminobutyric acid biosynthetic process	IEA
GO:0012506	Component	Vesicle membrane	NAS	10671565
GO:0016829	Function	Lyase activity	IEA
GO:0016830	Function	Carbon-carbon lyase activity	IEA
GO:0016831	Function	Carboxy-lyase activity	IEA
GO:0019752	Process	Carboxylic acid metabolic process	IEA
GO:0030170	Function	Pyridoxal phosphate binding	IEA
GO:0030424	Component	Axon	IEA
GO:0035176	Process	Social behavior	IEA
GO:0035641	Process	Locomotory exploration behavior	IEA
GO:0042802	Function	Identical protein binding	IDA	17384644
GO:0043679	Component	Axon terminus	IEA
GO:0044306	Component	Neuron projection terminus	IEA
GO:0045202	Component	Synapse	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048786	Component	Presynaptic active zone	IBA
GO:0048786	Component	Presynaptic active zone	IEA
GO:0060077	Component	Inhibitory synapse	IEA
GO:0061202	Component	Clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane	TAS
GO:0098793	Component	Presynapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA

Other IDs

• MIM: 605363
• HGNC: 4092
• e!Ensembl: ENSG00000128683

Protein

• UniProt ID: Q99259
• Protein name: Glutamate decarboxylase 1 (EC 4.1.1.15) (67 kDa glutamic acid decarboxylase) (GAD-67) (Glutamate decarboxylase 67 kDa isoform)
• Protein function: Catalyzes the synthesis of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA) with pyridoxal 5'-phosphate as cofactor. ; [Isoform 3]: Enzymatically inactive as glut
• PDB: 2OKJ, 3VP6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00282	Pyridoxal_deC	144 → 518	Pyridoxal-dependent decarboxylase conserved domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 1]: Expressed in brain. {ECO:0000269|PubMed:10671565}.; TISSUE SPECIFICITY: [Isoform 3]: Expressed in pancreatic islets, testis, adrenal cortex, and perhaps other endocrine tissues, but not in brain. {ECO:0000269|PubMed:106715
• Sequence:

  MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
  SRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
  VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
  RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
  SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEQSHYSIKKAGAA
  LGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIA
  DICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKE
  KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
  NKCLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGVPDSPQRREKLHKVAP
  KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL

• Sequence length: 594

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Developmental and epileptic encephalopathy 89	Pathogenic; Likely pathogenic	rs1161418050, rs2105795792, rs774772554, rs2105801986, rs1190356035, rs2468367688, rs1189720963, rs1181224255, rs1702866781, rs1702579715, rs1702611329, rs745595462	RCV001789738 RCV001789739 RCV001789740 RCV001789741 RCV002468714 RCV003226688 RCV003989971 RCV004820862 RCV001270690 RCV001270691 RCV001270692 RCV001270693	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neurodevelopmental disorder with progressive spasticity and brain white matter abnormalities	Likely pathogenic; Pathogenic	rs2468338472, rs1181224255, rs1575446166	RCV003044186 RCV001836863 RCV001836925	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL PALSY, SPASTIC QUADRIPLEGIC, 1	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHIARI-FROMMEL SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, MAJOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSKINESIA, DRUG-INDUCED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY INFANTILE EPILEPTIC ENCEPHALOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, PYRIDOXINE-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GAD1-related disorder	Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary spastic paraplegia	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPROLACTINEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Infantile spasms	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSOLETE EARLY INFANTILE EPILEPTIC ENCEPHALOPATHY	—	ClinGen	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyridoxine-dependent epilepsy	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Refractory epilepsy	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA, HEREDITARY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spastic quadriplegic cerebral palsy	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abnormal involuntary movement	Abnormal Involuntary Movement	BEFREE	28377741		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27080467		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31207151		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	24551133		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27080467		★☆☆☆☆ Found in Text Mining only
Agoraphobia	Agoraphobia	BEFREE	28806609, 31015099		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	29529524		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	31088538		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	29848208		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	17942900		★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	28092418		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	27355694, 27932242, 28088111, 28165775, 28324317, 28394850, 28490460, 28526049, 28554368, 29025788, 29499675, 29587759, 29644783, 29802770, 29986152, 30024942, 30054249, 30125814, 30125939, 30266030, 30293440, 30380815, 30428891, 30591033, 30599337, 30611061, 30637564, 30707735, 30728770, 30738930, 30762438, 30810345, 30870379, 31053070, 31054446, 31117829, 31181426, 31199570, 31226611, 31275123, 31302716, 31333520, 31346241, 31393408, 31498233, 31532238, 31571840, 31653679, 31759316		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	10368856, 16718280, 22328461, 22662185, 23906988, 27355694, 27932242, 28088111, 28165775, 28324317, 28394850, 28490460, 28494323, 28526049, 28554368, 28666201, 29025788, 29499675, 29587759, 29644783, 29802770, 29986152, 30024942, 30054249, 30125814, 30125939, 30266030, 30293440, 30380815, 30412618, 30428891, 30481992, 30591033, 30599337, 30611061, 30637564, 30707735, 30728770, 30738930, 30762438, 30810345, 30870379, 31053070, 31054446, 31117829, 31181426, 31199570, 31226611, 31275123, 31302716, 31333520, 31346241, 31393408, 31420734, 31498233, 31532238, 31571840, 31653679, 31759316, 31850603		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	27530595, 31758712		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	21302352, 24448211, 28229923		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	15542242, 17235515, 17918742, 19139806, 21302352, 30186123		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	17918742		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	21901839	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10209508, 10588452, 10679252, 12242463, 12865069, 17395515, 24340836, 24927554, 28364254, 28474159, 29501085, 7614998, 8143505, 8897011, 9404444		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10209508, 1924293, 21744463, 31733941, 8513574	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	31061195	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune polyendocrinopathy syndrome type 1	Autoimmune polyendocrine syndrome type 1	Pubtator	10594551	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	18218004		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11059795, 15684088, 15806582, 17442540, 18534564, 21184762, 22309971, 25364290, 25738424, 28710909		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	15560956		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	15684088, 17442540, 18294085, 26554713	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	19564623	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21184762, 22122643, 22309971, 25364290, 25738424		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	18294085		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	21226980, 25364290, 26554713		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	31100147	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	21226980, 25364290, 26554713		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29379318		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24551133	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30967437		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	18218004		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	34347922	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	15571623	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia, Late Onset	Cerebellar Ataxia	BEFREE	28321713		★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	BEFREE	29501085		★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar Diseases	BEFREE	28321713		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	15571623		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	15571623, 24228494	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral Palsy, Spastic Quadriplegic, 1	Cerebral palsy	GENOMICS_ENGLAND_DG	15571623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Palsy, Spastic Quadriplegic, 1	Cerebral palsy	UNIPROT_DG	15571623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Palsy, Spastic Quadriplegic, 1	Cerebral palsy	ORPHANET_DG	15571623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Palsy, Spastic Quadriplegic, 1	Cerebral palsy	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Palsy, Spastic Quadriplegic, 1	Cerebral palsy	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	27080467		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30967437		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29986152		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	29737428		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	15647480, 21632647		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21632647, 31100147	Associate	★☆☆☆☆ Found in Text Mining only
Congenital neurologic anomalies	Drachtman Weinblatt Sitarz syndrome	BEFREE	28762469		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27439062, 28958939		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25293974, 29194709		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10834414		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	26507232		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	15560956		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	18344044, 22662185, 25106036, 27586375, 28006984, 28057609, 28165775, 28242498, 28324317, 28394850, 28490460, 28554368, 28608287, 29025788, 29178857, 29343229, 29351138, 29362511, 29543833, 29665715, 29872956, 29966886, 30048513, 30125939, 30530884, 30550597, 30637564, 30684045, 30707735, 30762438, 30788386, 30870379, 30950896, 31181426, 31306998, 31346241, 31498233, 31759316		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	18344044, 19548263, 22662185, 25106036		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	21223646	Inhibit	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	28935211	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10078545, 10619986, 10724097, 10724349, 11772903, 12021103, 12087006, 12515288, 14693690, 16911619, 17325256, 18192540, 18299317, 18405999, 19590848, 20825955, 21376535, 21562325, 23228173, 23235561, 23712485, 26001397, 26138334, 28132100, 28987750, 29577424, 30280274, 30969375, 31713011, 8039604, 8666144, 8742569, 9892239		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10078545, 10619986, 10724097, 10724349, 11772903, 12021103, 12087006, 12515288, 14693690, 16911619, 17325256, 18192540, 18299317, 18405999, 19590848, 20825955, 21376535, 21562325, 21922456, 23228173, 23235561, 23712485, 26001397, 26138334, 28132100, 28986401, 28987750, 29577424, 30280274, 30969375, 31713011, 8039604, 8666144, 8742569, 9892239		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	10724349, 12153522, 18591848, 19494268, 20056952, 26631888, 27177031, 36150054, 36418577, 8513574	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	10594551, 10724349, 11228050, 11238556, 12153522, 1370298, 17392553, 1924293, 19881242, 21785903, 21831970, 22357962, 23600827, 26440526, 26981545, 27177031, 28534223, 28826655, 29459556, 32248243, 34347922, 34620611, 36817467, 7722468, 8245784, 8423231, 8426122, 9153283	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	26216138	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	11228050, 27177031	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10209508, 10422732, 10588452, 10619986, 10724349, 11606170, 11772903, 11978663, 12021103, 12358870, 12515288, 12687331, 1370298, 14578287, 14675393, 15699491, 15699499, 17130560, 17130562, 17325256, 17395515, 17768605, 18218004, 19018508, 1924335, 19833889, 20805278, 21044870, 21395678, 21490167, 21512962, 21515839, 21680149, 21831970, 22357962, 22960018, 23160529, 23539116, 24927554, 25422107, 25862998, 25935328, 26001397, 27704166, 28132100, 28357504, 28534223, 28826655, 28866779, 29288641, 29577424, 29579551, 29611765, 30009185, 30116734, 30693639, 30969375, 31095320, 31229619, 31713011, 7614998, 7681990, 7888043, 8143505, 8149657, 8370667, 8423231, 8426122, 8552991, 8666144, 8816974, 8897011, 9015682, 9048916, 9167107, 9185878, 9208924, 9344701, 9404444, 9551692, 9885897, 9892508		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10834414, 11606170, 12242463, 12865069, 14675393, 15533584, 15561950, 16009268, 16306339, 16911619, 18405999, 19808923, 19833889, 21411509, 24906951, 28986401, 29619531, 29737428, 30969375, 8742569, 9015668, 9250448, 9344701, 9892237		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	10422732, 12515288, 15056761, 17392553, 18056891, 19808923, 8666150		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30092018		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	30850713		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	29370977		★☆☆☆☆ Found in Text Mining only
Dyskinesia, Drug-Induced	Dyskinesia	CTD_human_DG	9767399		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	29053777		★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	29053777		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	29793465		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29370977, 31243582		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	31132202		★☆☆☆☆ Found in Text Mining only
Epilepsies, Partial	Epilepsy	BEFREE	30687213		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	12585688, 15571623, 25036107, 31525611	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	LHGDN	15571623		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	25036107, 28766694, 29017573, 29455082, 30057567, 30125939, 30788386, 31729196, 31759316		★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	12585688	Stimulate	★☆☆☆☆ Found in Text Mining only
EPILEPSY, PYRIDOXINE-DEPENDENT	Epilepsy	BEFREE	9621518		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	12585688		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	26369544		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	25935328		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25311416		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	10724349, 20825955, 9368637		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	10724349	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	18218004		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28958939		★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia	BEFREE	30179272		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16113600		★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	CTD_human_DG	7138674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypersensitivity Delayed	Hypersensitivity	Pubtator	37029735	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	15647480, 21632647, 24874453, 28689294, 30850713		★☆☆☆☆ Found in Text Mining only
Inherited congenital spastic tetraplegia	Hereditary Congenital Spastic Tetraplegia	Orphanet			★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	16505245, 20091020, 21873553, 28770319, 29343517		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Involutional Depression	Involutional Depression	CTD_human_DG	15560956		★☆☆☆☆ Found in Text Mining only
Involutional paraphrenia	Involutional Paraphrenia	CTD_human_DG	15560956		★☆☆☆☆ Found in Text Mining only
Juvenile Neuronal Ceroid Lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	15571623		★☆☆☆☆ Found in Text Mining only
Kernicterus	Kernicterus	BEFREE	28155818		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	30280274		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26001397		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30967437		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	15699499, 18056891, 9892237		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	18059616, 19001190, 20805278	Associate	★☆☆☆☆ Found in Text Mining only
Little`s Disease	Spastic diplegia	HPO_DG			★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	15806582		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	15806582		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	15806582		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	15806582		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	15806582		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	15806582		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	15806582		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	CTD_human_DG	15560956		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	16465480, 16718280, 21223646, 21226980, 24652383		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	16718280, 21226980, 24652383		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malformations of Cortical Development	Cortical development malformation	Pubtator	22159125	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29379318		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22072614		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30161002		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24804578, 26549033, 28400476, 28731789		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	15560956		★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	15560956		★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	15657605, 21395678, 21922456, 30181854, 9250448		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	18344044, 22662185, 25106036, 27586375, 28006984, 28057609, 28165775, 28242498, 28324317, 28394850, 28490460, 28554368, 28608287, 29025788, 29178857, 29351138, 29362511, 29543833, 29665715, 29872956, 29966886, 30048513, 30125939, 30530884, 30550597, 30637564, 30684045, 30707735, 30762438, 30788386, 30870379, 30950896, 31181426, 31306998, 31346241, 31498233, 31759316		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	18344044, 19548263, 22662185, 25106036		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	19110320, 22662185, 28710909, 29183310, 30233323		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	37029735	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28324317		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	29940002, 30341578, 31129003		★☆☆☆☆ Found in Text Mining only
Monogenic diabetes	Monogenic Diabetes	BEFREE	27271189		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	LHGDN	15806582		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	BEFREE	21223646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	21223646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	21223646	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	12774663		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31100147		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31100147	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	28163071		★☆☆☆☆ Found in Text Mining only
Myotonia Congenita	Myotonia congenita	Pubtator	25036107	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21955519, 22071966, 22072614, 24551133, 28245795, 31207151		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	1370298	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	21632647, 24804578, 28321713, 29017573, 29501085, 30125939, 31181426		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29379112		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	17586305		★☆☆☆☆ Found in Text Mining only
Neuronal Ceroid-Lipofuscinoses	Neuronal Ceroid Lipofuscinosis	LHGDN	15571623		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	1370298, 21680149		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	11059795, 15684088, 15864560, 16759710, 25458568, 27753212, 27967329, 28122016		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	BEFREE	29501085		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22072614		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19881242	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	19881242	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	22662185, 23906988, 29758471, 30107264		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	22662185	Associate	★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	29529524		★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	20644278	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11529246, 12376704, 17203488, 17586305, 21419704, 21449035, 23331189, 7582093, 8618687		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	12376704		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	20832408	Inhibit	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	23891794, 28405611, 37684533	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29737428		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	29343229, 29940002, 30380815, 30591033, 31291233		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30161002		★☆☆☆☆ Found in Text Mining only
Psychosis, Involutional	Psychosis	CTD_human_DG	15560956		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	11059795, 15684088, 15864560, 16759710, 25458568, 27753212, 27967329, 28122016		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	15684088, 22948384	Associate	★☆☆☆☆ Found in Text Mining only
Pyridoxine dependent epilepsy	Pyridoxine dependent epilepsy	Pubtator	10978228	Associate	★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	30654995		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24551133, 25293974		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29137274		★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	24993056		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10711910, 11592844, 12867516, 15091314, 15114630, 15237077, 15505639, 15647480, 15671176, 15684088, 15700048, 15806582, 15864560, 16513879, 16574235, 17179443, 17264840, 17270400, 17303389, 17412563, 17471287, 17726539, 17767149, 17942719, 17961987, 18335162, 18395805, 18534564, 18923069, 19110320, 19187942, 20100621, 20125089, 21223646, 21632647, 21795557, 22036037, 22122643, 22309971, 22496567, 23864674, 24702539, 24874453, 24912493, 24993056, 25072323, 25364290, 25458568, 25464914, 25476119, 25660468, 25738424, 26812044, 26822489, 26848839, 27550734, 27884423, 28122016, 28485403, 29017573, 29174863, 29362511, 30051606, 30341396, 31062628, 31068131, 31780643		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15114630, 15505639, 17412563, 17471287, 17767149, 18335162		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	15560956, 17942719, 18923069, 19110320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	15684088, 19564623, 21223646, 21632647	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	17270400, 17553960, 17961987, 18294085, 22159125, 22496567, 25660468, 27021555, 27328999	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia and related disorders	Schizophrenia	BEFREE	16759710		★☆☆☆☆ Found in Text Mining only
Schizophrenia, Childhood	Schizophrenia	BEFREE	15505639, 18294085		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	31015099		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	12585688	Associate	★☆☆☆☆ Found in Text Mining only
Separation Anxiety Disorder	Separation Anxiety Disorder	BEFREE	16465480		★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	28806609, 30293440, 31571840		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	30707735		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	29940002		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26631888	Associate	★☆☆☆☆ Found in Text Mining only
Spastic Quadriplegia	Spastic Quadriplegia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stiff-Person Syndrome	Stiff-Person Syndrome	BEFREE	11094109, 15571623, 21680149, 31410334		★☆☆☆☆ Found in Text Mining only
Stiff-Person Syndrome	Stiff-Person Syndrome	LHGDN	15571623		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	28684768		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	20825955		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	14681921, 16718280, 24652383		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	16465480, 16718280, 21223646, 21226980, 24652383		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	15103710		★☆☆☆☆ Found in Text Mining only
Wolfram Syndrome	Wolfram syndrome	Pubtator	16442662	Associate	★☆☆☆☆ Found in Text Mining only