Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	53822
Gene name	FXYD domain containing ion transport regulator 7
Gene symbol	FXYD7
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19q13.12
Summary	This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the se

15 Show/Hide all (15)

miRTarBase ID	miRNA	Experiments
MIRT1998519	hsa-miR-4479	CLIP-seq
MIRT1998520	hsa-miR-4505	CLIP-seq
MIRT2388281	hsa-miR-1275	CLIP-seq
MIRT2388282	hsa-miR-1280	CLIP-seq
MIRT2388283	hsa-miR-1281	CLIP-seq
MIRT2388284	hsa-miR-4260	CLIP-seq
MIRT1998519	hsa-miR-4479	CLIP-seq
MIRT1998520	hsa-miR-4505	CLIP-seq
MIRT2388285	hsa-miR-4525	CLIP-seq
MIRT2388286	hsa-miR-4665-5p	CLIP-seq
MIRT2388287	hsa-miR-4723-5p	CLIP-seq
MIRT2388288	hsa-miR-616	CLIP-seq
MIRT2388289	hsa-miR-625	CLIP-seq
MIRT2388290	hsa-miR-638	CLIP-seq
MIRT2388291	hsa-miR-9	CLIP-seq

12 Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0017080	Function	Sodium channel regulator activity	IBA
GO:0043269	Process	Regulation of monoatomic ion transport	IEA
GO:0051117	Function	ATPase binding	IEA
GO:0099106	Function	Ion channel regulator activity	IEA
GO:1903278	Process	Positive regulation of sodium ion export across plasma membrane	IBA

MIM	HGNC	e!Ensembl
606684	4034	ENSG00000221946

P58549

Protein name

FXYD domain-containing ion transport regulator 7

Protein function

Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane (PubMed:33231612). Reduces the apparen

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02038	ATP1G1_PLM_MAT8	13 → 60	ATP1G1/PLM/MAT8 family	Family

Sequence

MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSES
PTCKSCKSELPSSAPGGGGV

Sequence length

Interactions

View interactions

Reactome Pathway
Ion homeostasis
Ion transport by P-type ATPases

FXYD7 (FXYD domain containing ion transport regulator 7)

Save This Analysis