FSTL5 (follistatin like 5)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 56884
• Gene name: Follistatin like 5
• Gene symbol: FSTL5
• Synonyms (NCBI Gene): -
• Chromosome: 4
• Chromosome location: 4q32.2

miRNA Show/Hide all (21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1005621	hsa-miR-1290	CLIP-seq
MIRT1005622	hsa-miR-129-5p	CLIP-seq
MIRT1005623	hsa-miR-1305	CLIP-seq
MIRT1005624	hsa-miR-1323	CLIP-seq
MIRT1005625	hsa-miR-3143	CLIP-seq
MIRT1005626	hsa-miR-450b-5p	CLIP-seq
MIRT1005627	hsa-miR-507	CLIP-seq
MIRT1005628	hsa-miR-543	CLIP-seq
MIRT1005629	hsa-miR-548o	CLIP-seq
MIRT1005630	hsa-miR-557	CLIP-seq
MIRT1005631	hsa-miR-607	CLIP-seq
MIRT1005632	hsa-miR-624	CLIP-seq
MIRT2231646	hsa-miR-224	CLIP-seq
MIRT1005622	hsa-miR-129-5p	CLIP-seq
MIRT1005625	hsa-miR-3143	CLIP-seq
MIRT1005626	hsa-miR-450b-5p	CLIP-seq
MIRT1005627	hsa-miR-507	CLIP-seq
MIRT1005628	hsa-miR-543	CLIP-seq
MIRT1005630	hsa-miR-557	CLIP-seq
MIRT2449928	hsa-miR-1251	CLIP-seq
MIRT2449929	hsa-miR-4267	CLIP-seq

Gene ontology (GO) Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	24407287
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030510	Process	Regulation of BMP signaling pathway	IBA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 620128
• HGNC: 21386
• e!Ensembl: ENSG00000168843

Protein

• UniProt ID: Q8N475
• Protein name: Follistatin-related protein 5 (Follistatin-like protein 5)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07648	Kazal_2	87 → 149	Kazal-type serine protease inhibitor domain	Domain
  PF13927	Ig_3	340 → 417		Domain
  PF13927	Ig_3	249 → 324		Domain

• Sequence:

  MFKCWSVVLVLGFIFLESEGRPTKEGGYGLKSYQPLMRLRHKQEKNQESSRVKGFMIQDG
  PFGSCENKYCGLGRHCVTSRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVHRAACL
  KKQKITIVHNEDCFFKGDKCKTTEYSKMKNMLLDLQNQKYIMQENENPNGDDISRKKLLV
  DQMFKYFDADSNGLVDINELTQVIKQEELGKDLFDCTLYVLLKYDDFNADKHLALEEFYR
  AFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPIIWKRNNIILNNLDLEDINDF
  GDDGSLYITKVTTTHVGNYTCYADGYEQVYQTHIFQVNVPPVIRVYPESQAREPGVTASL
  RCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIAKNEAG
  VDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSE
  KLLGFQDEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVVQAVST
  DPVPVKLHYDKSHDQVWVLSWGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQFDRVDD
  FFIPTTTLIITHMRFGFILHKDEAALQKIDLETMSYIKTINLKDYKCVPQSLAYTHLGGY
  YFIGCKPDSTGAVSPQVMVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDVKGLVRVQY
  ITIRGEIQEAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKMIK
  SLKEPLKAEEWPWNRKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNT
  VIWVGDA

• Sequence length: 847

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (23)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	35694926	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	33686288	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	33686288	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	31043756, 33686288	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	31043756	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY	—	GWAS catalog	34020725	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	35694926	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	31092297	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	21310492	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	30177863	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	33686288, 34734193	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	29559693	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	39503264	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	38538606	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	38538606	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DETACHMENT	—	GWAS catalog	31816047	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	35396580	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	31092297, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (22)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Medulloblastoma	Medulloblastoma	BEFREE	21911727		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	32647207	Stimulate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	31043756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26045876	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32740091	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	21911727		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25023989, 36067202	Associate	★☆☆☆☆ Found in Text Mining only
Depressed bipolar I disorder	Depressed bipolar disorder	GWASCAT_DG	31043756		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	31043756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	32647207	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26045876, 30255547		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32740091	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30255547		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26045876		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	31043756		★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	31043756		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	21911727		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26045876, 30255547		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	40420762	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

GPR158 3 shared diseasesDiabetic neuropathy, Diabetic retinopathy, Diverticular disease 3 shared evidence sourcesGWAS catalog (Diabetic neuropathy), GWAS catalog (Diabetic retinopathy), GWAS catalog (Diverticular disease) Related via 3 shared diseases including Diabetic neuropathy, Diabetic retinopathy — evidence mostly GWAS catalog. AGMO 4 shared diseasesCataract, Diabetic neuropathy, Diabetic retinopathy, Diverticular disease 4 shared evidence sourcesGWAS catalog (Cataract), GWAS catalog (Diabetic neuropathy), GWAS catalog (Diabetic retinopathy), GWAS catalog (Diverticular disease) Related via 4 shared diseases including Cataract, Diabetic neuropathy — evidence mostly GWAS catalog. POU3F2 2 shared diseasesCerebral amyloid angiopathy, Bipolar depression 3 shared evidence sourcesCTD (Bipolar disorder), GWAS catalog (Cerebral amyloid angiopathy), Disgenet (Bipolar depression) Related via 2 shared diseases including Cerebral amyloid angiopathy, Bipolar depression — evidence mostly CTD. VSTM4 2 shared diseasesCataract, Diverticular disease 2 shared evidence sourcesGWAS catalog (Cataract), GWAS catalog (Diverticular disease) Related via 2 shared diseases including Cataract, Diverticular disease — evidence mostly GWAS catalog. BMP3 2 shared diseasesCataract, Retinal detachment 2 shared evidence sourcesGWAS catalog (Cataract), GWAS catalog (Retinal detachment) Related via 2 shared diseases including Cataract, Retinal detachment — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GPR158	3	["Diabetic neuropathy","Diabetic retinopathy","Diverticular disease"]	0	[]	3	["GWAS catalog (Diabetic neuropathy)","GWAS catalog (Diabetic retinopathy)","GWAS catalog (Diverticular disease)"]
AGMO	4	["Cataract","Diabetic neuropathy","Diabetic retinopathy","Diverticular disease"]	0	[]	4	["GWAS catalog (Cataract)","GWAS catalog (Diabetic neuropathy)","GWAS catalog (Diabetic retinopathy)","GWAS catalog (Diverticular disease)"]
POU3F2	2	["Cerebral amyloid angiopathy","Bipolar depression"]	0	[]	3	["CTD (Bipolar disorder)","GWAS catalog (Cerebral amyloid angiopathy)","Disgenet (Bipolar depression)"]
VSTM4	2	["Cataract","Diverticular disease"]	0	[]	2	["GWAS catalog (Cataract)","GWAS catalog (Diverticular disease)"]
BMP3	2	["Cataract","Retinal detachment"]	0	[]	2	["GWAS catalog (Cataract)","GWAS catalog (Retinal detachment)"]

Diseases Linked via Similar Genes

Hypertension Linked via 2 of 5 related genesGPR158, AGMO Obesity Linked via 2 of 5 related genesAGMO, POU3F2 Scoliosis Linked via 2 of 5 related genesAGMO, POU3F2 Hepatocellular carcinoma Linked via 1 of 5 related genesGPR158 Ovarian epithelial cancer Linked via 1 of 5 related genesGPR158

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Hypertension	2	["GPR158","AGMO"]
Obesity	2	["AGMO","POU3F2"]
Scoliosis	2	["AGMO","POU3F2"]
Hepatocellular carcinoma	1	["GPR158"]
Ovarian epithelial cancer	1	["GPR158"]