Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	23150
Gene name	FERM domain containing 4B
Gene symbol	FRMD4B
Synonyms (NCBI Gene)	6030440G05RikGRSP1
Chromosome	3
Chromosome location	3p14.1
Summary	This gene encodes a GRP1-binding protein which contains a FERM protein interaction domain as well as two coiled coil domains. This protein may play a role as a scaffolding protein. [provided by RefSeq, Mar 2014]

47 Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019072	hsa-miR-335-5p	Microarray	18185580
MIRT021453	hsa-miR-9-5p	Microarray	17612493
MIRT027864	hsa-miR-98-5p	Microarray	19088304
MIRT1004546	hsa-miR-1184	CLIP-seq
MIRT1004547	hsa-miR-1301	CLIP-seq
MIRT1004548	hsa-miR-2355-5p	CLIP-seq
MIRT1004549	hsa-miR-3164	CLIP-seq
MIRT1004550	hsa-miR-3614-5p	CLIP-seq
MIRT1004551	hsa-miR-3679-3p	CLIP-seq
MIRT1004552	hsa-miR-432	CLIP-seq
MIRT1004553	hsa-miR-4418	CLIP-seq
MIRT1004554	hsa-miR-4446-5p	CLIP-seq
MIRT1004555	hsa-miR-4453	CLIP-seq
MIRT1004556	hsa-miR-4521	CLIP-seq
MIRT1004557	hsa-miR-4538	CLIP-seq
MIRT1004558	hsa-miR-4633-3p	CLIP-seq
MIRT1004559	hsa-miR-4660	CLIP-seq
MIRT1004560	hsa-miR-4686	CLIP-seq
MIRT1004561	hsa-miR-495	CLIP-seq
MIRT1004562	hsa-miR-5047	CLIP-seq
MIRT1004563	hsa-miR-509-3-5p	CLIP-seq
MIRT1004564	hsa-miR-509-5p	CLIP-seq
MIRT1004565	hsa-miR-579	CLIP-seq
MIRT1004566	hsa-miR-606	CLIP-seq
MIRT1004567	hsa-miR-668	CLIP-seq
MIRT1004568	hsa-miR-890	CLIP-seq
MIRT1004550	hsa-miR-3614-5p	CLIP-seq
MIRT2231452	hsa-miR-1297	CLIP-seq
MIRT2231453	hsa-miR-200b	CLIP-seq
MIRT2231454	hsa-miR-200c	CLIP-seq
MIRT2231455	hsa-miR-26a	CLIP-seq
MIRT2231456	hsa-miR-26b	CLIP-seq
MIRT2231457	hsa-miR-323b-3p	CLIP-seq
MIRT2231458	hsa-miR-3647-3p	CLIP-seq
MIRT2231459	hsa-miR-4267	CLIP-seq
MIRT2231460	hsa-miR-4275	CLIP-seq
MIRT2231461	hsa-miR-4276	CLIP-seq
MIRT2231462	hsa-miR-429	CLIP-seq
MIRT2231463	hsa-miR-433	CLIP-seq
MIRT2231464	hsa-miR-4465	CLIP-seq
MIRT2231465	hsa-miR-4668-3p	CLIP-seq
MIRT2231466	hsa-miR-4771	CLIP-seq
MIRT2231467	hsa-miR-4775	CLIP-seq
MIRT2231468	hsa-miR-4799-5p	CLIP-seq
MIRT2231469	hsa-miR-499a-5p	CLIP-seq
MIRT2231470	hsa-miR-590-3p	CLIP-seq
MIRT2231471	hsa-miR-944	CLIP-seq

11 Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IEA
GO:0005615	Component	Extracellular space	HDA	23580065
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005912	Component	Adherens junction	IBA
GO:0005912	Component	Adherens junction	IEA
GO:0005923	Component	Bicellular tight junction	IBA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0090162	Process	Establishment of epithelial cell polarity	IEA
GO:0090162	Process	Establishment of epithelial cell polarity	IEA

MIM	HGNC	e!Ensembl
617467	24886	ENSG00000114541

Q9Y2L6

Protein name

FERM domain-containing protein 4B (GRP1-binding protein GRSP1)

Protein function

Member of GRP1 signaling complexes that are acutely recruited to plasma membrane ruffles in response to insulin receptor signaling. May function as a scaffolding protein that regulates epithelial cell polarity by connecting ARF6 activation with

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00373	FERM_M	144 → 260	FERM central domain	Domain
PF09379	FERM_N	63 → 125	FERM N-terminal domain	Domain
PF09380	FERM_C	264 → 365	FERM C-terminal PH-like domain	Domain
PF11819	CUPID	395 → 529	Cytohesin Ubiquitin Protein Inducing Domain	Domain

Sequence

MASVFMCGVEDLLFSGSRFVWNLTVSTLRRWYTERLRACHQVLRTWCGLQDVYQMTEGRH
CQVHLLDDRRLELLVQPKLLARELLDLVASHFNLKEKEYFGITFIDDTGQQNWLQLDHRV
LDHDLPKKPGPTILHFAVRFYIESISFLKDKTTVELFFLNAKACVHKGQIEVESETIFKL
AAFILQEAKGDYTSDENARKDLKTLPAFPTKTLQEHPSLAYCEDRVIEHYLKIKGLTRGQ
AVVQYMKIVEALPTYGVHYYAVKDKQGLPWWLGISYKGIGQYDIQDKVKPRKLFQWKQLE
NLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANSSLIKSIWVMAISQHQFYLDR
KQSKAKIPSARSLDEIAMDLTETGTQRASKLVTLETKSQFIMASNGSLISSGSQDSEVSE
EQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEYPLNIGEKPPQVRRR
VGTAFKLDDNLLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKKRKQDYTD
AMKKLQEIENAINEYRIRCGKKPSQKATVLPEDIIPSESSSLSDTTTYDDPSDAFTFPGQ
RSSSVPHSPRILPPKSLGIERIHFRKSSINEQFVDTRQSREMLSTHSSPYKTLERRPQGG
RSMPTTPVLTRNAYSSSHLEPESSSQHCRQRSGSLESQSHLLSEMDSDKPFFSLSKSQRS
SSTEILDDGSSYTSQSSTEYYCVTPVTGPYYTTQTLDTRTRGRRRSKKQNVSTSNSGSMP
NLAQKDSLRNGVYSKSQEPPSSSYYIAGYTPYAECDFYYSGGYVYENDTEGQYSVNPSYR
SSAHYGYERQRDYSRSFHEDEVDRVPHNPYATLRLPRKAAAKSEHITKNIHKALVAEHLR
GWYQRASGQKDQGHSPQTSFDSDRGSQRCLGFAGLQVPCSPSSRASSYSSVSSTNASGNW
RTQLTIGLSDYETPAHSSYTSCYGNVYNPLPSPSRQYTEISQLDGTDGNQLEDNLESSEQ
RLFWHEDSKPGTLV

Sequence length

1034

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (18)
ALZHEIMER DISEASE	—	GWAS catalog	22881374	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	29892015, 30061737, 30061737, 34594039, 35872910, 36653681, 39537608, 40050429, 40645996	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	20190752, 31591516	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	32238385	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	34343768	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	22881374	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	39358599	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	39358599	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	26198764	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (14)
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	25380588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015, 30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	20718813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASDB_DG	20190752		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	GWASCAT_DG	20190752		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	BEFREE	24999842		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	24999842	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	20124441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enhanced S-Cone Syndrome	Enhanced S-Cone Syndrome	BEFREE	29947801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	20124441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	20124441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015, 30061737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29313708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FRMD4B (FERM domain containing 4B)

Save This Analysis