XPO1 (exportin 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7514
• Gene name: Exportin 1
• Gene symbol: XPO1
• Synonyms (NCBI Gene): CRM-1, CRM1, emb, exp1
• Chromosome: 2
• Chromosome location: 2p15
• Summary: This cell-cycle-regulated gene encodes a protein that mediates leucine-rich nuclear export signal (NES)-dependent protein transport. The protein specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellula

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057520009	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057520010	T>A,G	Likely-pathogenic	Missense variant, coding sequence variant

miRNA Show/Hide all (229)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016294	hsa-miR-193b-3p	Proteomics	21512034
MIRT020549	hsa-miR-155-5p	Proteomics	18668040
MIRT026224	hsa-miR-192-5p	Microarray	19074876
MIRT028476	hsa-miR-30a-5p	Proteomics	18668040
MIRT031490	hsa-miR-16-5p	Proteomics	18668040
MIRT050787	hsa-miR-17-3p	CLASH	23622248
MIRT049604	hsa-miR-92a-3p	CLASH	23622248
MIRT046310	hsa-miR-23b-3p	CLASH	23622248
MIRT045717	hsa-miR-125a-5p	CLASH	23622248
MIRT036257	hsa-miR-1236-3p	CLASH	23622248
MIRT545981	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT545980	hsa-miR-4453	PAR-CLIP	20371350
MIRT545979	hsa-miR-4538	PAR-CLIP	20371350
MIRT545981	hsa-miR-224-5p	PAR-CLIP	21572407
MIRT545980	hsa-miR-4453	PAR-CLIP	21572407
MIRT545979	hsa-miR-4538	PAR-CLIP	21572407
MIRT028476	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT206889	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT206887	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT206890	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT206888	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT545981	hsa-miR-224-5p	PAR-CLIP	21572407
MIRT545980	hsa-miR-4453	PAR-CLIP	21572407
MIRT545979	hsa-miR-4538	PAR-CLIP	21572407
MIRT545978	hsa-miR-4495	PAR-CLIP	21572407
MIRT439277	hsa-miR-485-5p	HITS-CLIP	24374217
MIRT439276	hsa-miR-382-5p	HITS-CLIP	24374217
MIRT439277	hsa-miR-485-5p	HITS-CLIP	24374217
MIRT439276	hsa-miR-382-5p	HITS-CLIP	24374217
MIRT733811	hsa-let-7f-2-3p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	31570982
MIRT545981	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT545980	hsa-miR-4453	PAR-CLIP	20371350
MIRT545979	hsa-miR-4538	PAR-CLIP	20371350
MIRT545981	hsa-miR-224-5p	PAR-CLIP	21572407
MIRT545980	hsa-miR-4453	PAR-CLIP	21572407
MIRT545979	hsa-miR-4538	PAR-CLIP	21572407
MIRT028476	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT206889	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT206887	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT206890	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT206888	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT545981	hsa-miR-224-5p	PAR-CLIP	21572407
MIRT545980	hsa-miR-4453	PAR-CLIP	21572407
MIRT545979	hsa-miR-4538	PAR-CLIP	21572407
MIRT545978	hsa-miR-4495	PAR-CLIP	21572407
MIRT1496452	hsa-miR-133a	CLIP-seq
MIRT1496453	hsa-miR-133b	CLIP-seq
MIRT1496454	hsa-miR-142-3p	CLIP-seq
MIRT1496455	hsa-miR-190	CLIP-seq
MIRT1496456	hsa-miR-190b	CLIP-seq
MIRT1496457	hsa-miR-1910	CLIP-seq
MIRT1496458	hsa-miR-2053	CLIP-seq
MIRT1496459	hsa-miR-2054	CLIP-seq
MIRT1496460	hsa-miR-2116	CLIP-seq
MIRT1496461	hsa-miR-219-1-3p	CLIP-seq
MIRT1496462	hsa-miR-224	CLIP-seq
MIRT1496463	hsa-miR-30a	CLIP-seq
MIRT1496464	hsa-miR-30b	CLIP-seq
MIRT1496465	hsa-miR-30c	CLIP-seq
MIRT1496466	hsa-miR-30d	CLIP-seq
MIRT1496467	hsa-miR-30e	CLIP-seq
MIRT1496468	hsa-miR-3121-3p	CLIP-seq
MIRT1496469	hsa-miR-3140-3p	CLIP-seq
MIRT1496470	hsa-miR-3152-5p	CLIP-seq
MIRT1496471	hsa-miR-33a	CLIP-seq
MIRT1496472	hsa-miR-33b	CLIP-seq
MIRT1496473	hsa-miR-361-3p	CLIP-seq
MIRT1496474	hsa-miR-3616-5p	CLIP-seq
MIRT1496475	hsa-miR-3647-5p	CLIP-seq
MIRT1496476	hsa-miR-3671	CLIP-seq
MIRT1496477	hsa-miR-3682-3p	CLIP-seq
MIRT1496478	hsa-miR-374c	CLIP-seq
MIRT1496479	hsa-miR-3929	CLIP-seq
MIRT1496480	hsa-miR-4255	CLIP-seq
MIRT1496481	hsa-miR-4305	CLIP-seq
MIRT1496482	hsa-miR-4311	CLIP-seq
MIRT1496483	hsa-miR-4315	CLIP-seq
MIRT1496484	hsa-miR-4419b	CLIP-seq
MIRT1496485	hsa-miR-4424	CLIP-seq
MIRT1496486	hsa-miR-4444	CLIP-seq
MIRT1496487	hsa-miR-4478	CLIP-seq
MIRT1496488	hsa-miR-450b-5p	CLIP-seq
MIRT1496489	hsa-miR-4528	CLIP-seq
MIRT1496490	hsa-miR-455-3p	CLIP-seq
MIRT1496491	hsa-miR-4642	CLIP-seq
MIRT1496492	hsa-miR-4659a-3p	CLIP-seq
MIRT1496493	hsa-miR-4659b-3p	CLIP-seq
MIRT1496494	hsa-miR-4666-5p	CLIP-seq
MIRT1496495	hsa-miR-4677-5p	CLIP-seq
MIRT1496496	hsa-miR-4690-3p	CLIP-seq
MIRT1496497	hsa-miR-4762-5p	CLIP-seq
MIRT1496498	hsa-miR-4774-3p	CLIP-seq
MIRT1496499	hsa-miR-4775	CLIP-seq
MIRT1496500	hsa-miR-4790-5p	CLIP-seq
MIRT1496501	hsa-miR-501-3p	CLIP-seq
MIRT1496502	hsa-miR-502-3p	CLIP-seq
MIRT1496503	hsa-miR-507	CLIP-seq
MIRT1496504	hsa-miR-520d-5p	CLIP-seq
MIRT1496505	hsa-miR-524-5p	CLIP-seq
MIRT1496506	hsa-miR-557	CLIP-seq
MIRT1496507	hsa-miR-562	CLIP-seq
MIRT1496508	hsa-miR-569	CLIP-seq
MIRT1496509	hsa-miR-571	CLIP-seq
MIRT1496510	hsa-miR-573	CLIP-seq
MIRT1496511	hsa-miR-590-3p	CLIP-seq
MIRT1496512	hsa-miR-607	CLIP-seq
MIRT1496513	hsa-miR-645	CLIP-seq
MIRT1496514	hsa-miR-655	CLIP-seq
MIRT2149435	hsa-miR-103a	CLIP-seq
MIRT2149436	hsa-miR-107	CLIP-seq
MIRT2149437	hsa-miR-1238	CLIP-seq
MIRT2149438	hsa-miR-1324	CLIP-seq
MIRT1496452	hsa-miR-133a	CLIP-seq
MIRT1496453	hsa-miR-133b	CLIP-seq
MIRT1496454	hsa-miR-142-3p	CLIP-seq
MIRT1496455	hsa-miR-190	CLIP-seq
MIRT1496456	hsa-miR-190b	CLIP-seq
MIRT1496457	hsa-miR-1910	CLIP-seq
MIRT2149439	hsa-miR-2052	CLIP-seq
MIRT1496460	hsa-miR-2116	CLIP-seq
MIRT1496462	hsa-miR-224	CLIP-seq
MIRT1496463	hsa-miR-30a	CLIP-seq
MIRT1496464	hsa-miR-30b	CLIP-seq
MIRT1496465	hsa-miR-30c	CLIP-seq
MIRT1496466	hsa-miR-30d	CLIP-seq
MIRT1496467	hsa-miR-30e	CLIP-seq
MIRT1496471	hsa-miR-33a	CLIP-seq
MIRT1496472	hsa-miR-33b	CLIP-seq
MIRT1496474	hsa-miR-3616-5p	CLIP-seq
MIRT1496475	hsa-miR-3647-5p	CLIP-seq
MIRT1496477	hsa-miR-3682-3p	CLIP-seq
MIRT2149440	hsa-miR-371-5p	CLIP-seq
MIRT2149441	hsa-miR-371b-5p	CLIP-seq
MIRT1496480	hsa-miR-4255	CLIP-seq
MIRT2149442	hsa-miR-4284	CLIP-seq
MIRT1496481	hsa-miR-4305	CLIP-seq
MIRT1496482	hsa-miR-4311	CLIP-seq
MIRT1496483	hsa-miR-4315	CLIP-seq
MIRT2149443	hsa-miR-4422	CLIP-seq
MIRT1496485	hsa-miR-4424	CLIP-seq
MIRT1496486	hsa-miR-4444	CLIP-seq
MIRT2149444	hsa-miR-4493	CLIP-seq
MIRT1496489	hsa-miR-4528	CLIP-seq
MIRT1496490	hsa-miR-455-3p	CLIP-seq
MIRT1496491	hsa-miR-4642	CLIP-seq
MIRT1496495	hsa-miR-4677-5p	CLIP-seq
MIRT1496496	hsa-miR-4690-3p	CLIP-seq
MIRT2149445	hsa-miR-4719	CLIP-seq
MIRT1496499	hsa-miR-4775	CLIP-seq
MIRT1496500	hsa-miR-4790-5p	CLIP-seq
MIRT2149446	hsa-miR-500a	CLIP-seq
MIRT1496501	hsa-miR-501-3p	CLIP-seq
MIRT2149447	hsa-miR-501-5p	CLIP-seq
MIRT1496502	hsa-miR-502-3p	CLIP-seq
MIRT1496508	hsa-miR-569	CLIP-seq
MIRT1496510	hsa-miR-573	CLIP-seq
MIRT2149435	hsa-miR-103a	CLIP-seq
MIRT2149436	hsa-miR-107	CLIP-seq
MIRT2149438	hsa-miR-1324	CLIP-seq
MIRT1496455	hsa-miR-190	CLIP-seq
MIRT1496456	hsa-miR-190b	CLIP-seq
MIRT1496457	hsa-miR-1910	CLIP-seq
MIRT2149439	hsa-miR-2052	CLIP-seq
MIRT1496458	hsa-miR-2053	CLIP-seq
MIRT1496459	hsa-miR-2054	CLIP-seq
MIRT1496460	hsa-miR-2116	CLIP-seq
MIRT1496461	hsa-miR-219-1-3p	CLIP-seq
MIRT1496463	hsa-miR-30a	CLIP-seq
MIRT1496464	hsa-miR-30b	CLIP-seq
MIRT1496465	hsa-miR-30c	CLIP-seq
MIRT1496466	hsa-miR-30d	CLIP-seq
MIRT1496467	hsa-miR-30e	CLIP-seq
MIRT1496474	hsa-miR-3616-5p	CLIP-seq
MIRT1496475	hsa-miR-3647-5p	CLIP-seq
MIRT1496477	hsa-miR-3682-3p	CLIP-seq
MIRT1496478	hsa-miR-374c	CLIP-seq
MIRT1496480	hsa-miR-4255	CLIP-seq
MIRT2149442	hsa-miR-4284	CLIP-seq
MIRT1496481	hsa-miR-4305	CLIP-seq
MIRT1496482	hsa-miR-4311	CLIP-seq
MIRT1496483	hsa-miR-4315	CLIP-seq
MIRT2149443	hsa-miR-4422	CLIP-seq
MIRT1496485	hsa-miR-4424	CLIP-seq
MIRT1496486	hsa-miR-4444	CLIP-seq
MIRT2149444	hsa-miR-4493	CLIP-seq
MIRT1496489	hsa-miR-4528	CLIP-seq
MIRT1496490	hsa-miR-455-3p	CLIP-seq
MIRT1496492	hsa-miR-4659a-3p	CLIP-seq
MIRT1496493	hsa-miR-4659b-3p	CLIP-seq
MIRT1496494	hsa-miR-4666-5p	CLIP-seq
MIRT1496495	hsa-miR-4677-5p	CLIP-seq
MIRT2149445	hsa-miR-4719	CLIP-seq
MIRT1496499	hsa-miR-4775	CLIP-seq
MIRT1496500	hsa-miR-4790-5p	CLIP-seq
MIRT2149446	hsa-miR-500a	CLIP-seq
MIRT1496501	hsa-miR-501-3p	CLIP-seq
MIRT2149447	hsa-miR-501-5p	CLIP-seq
MIRT1496502	hsa-miR-502-3p	CLIP-seq
MIRT1496508	hsa-miR-569	CLIP-seq
MIRT1496509	hsa-miR-571	CLIP-seq
MIRT1496510	hsa-miR-573	CLIP-seq
MIRT1496511	hsa-miR-590-3p	CLIP-seq
MIRT1496513	hsa-miR-645	CLIP-seq
MIRT1496514	hsa-miR-655	CLIP-seq
MIRT1496470	hsa-miR-3152-5p	CLIP-seq
MIRT1496473	hsa-miR-361-3p	CLIP-seq
MIRT1496496	hsa-miR-4690-3p	CLIP-seq
MIRT1496498	hsa-miR-4774-3p	CLIP-seq
MIRT2149437	hsa-miR-1238	CLIP-seq
MIRT1496452	hsa-miR-133a	CLIP-seq
MIRT1496453	hsa-miR-133b	CLIP-seq
MIRT2663552	hsa-miR-2467-3p	CLIP-seq
MIRT2663553	hsa-miR-3678-3p	CLIP-seq
MIRT2663554	hsa-miR-3919	CLIP-seq
MIRT1496491	hsa-miR-4642	CLIP-seq
MIRT1496499	hsa-miR-4775	CLIP-seq
MIRT1496504	hsa-miR-520d-5p	CLIP-seq
MIRT1496505	hsa-miR-524-5p	CLIP-seq
MIRT2663555	hsa-miR-892a	CLIP-seq
MIRT2149437	hsa-miR-1238	CLIP-seq
MIRT1496452	hsa-miR-133a	CLIP-seq
MIRT1496453	hsa-miR-133b	CLIP-seq
MIRT2663552	hsa-miR-2467-3p	CLIP-seq
MIRT2663553	hsa-miR-3678-3p	CLIP-seq
MIRT2663554	hsa-miR-3919	CLIP-seq
MIRT1496491	hsa-miR-4642	CLIP-seq
MIRT1496499	hsa-miR-4775	CLIP-seq
MIRT1496504	hsa-miR-520d-5p	CLIP-seq
MIRT1496505	hsa-miR-524-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYC	Activation	22284678
TP53	Repression	22284678

Gene ontology (GO) Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000054	Process	Ribosomal subunit export from nucleus	IMP	12724356
GO:0000055	Process	Ribosomal large subunit export from nucleus	IBA
GO:0000055	Process	Ribosomal large subunit export from nucleus	IMP	12773398
GO:0000056	Process	Ribosomal small subunit export from nucleus	IBA
GO:0000056	Process	Ribosomal small subunit export from nucleus	IMP	12773398
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000776	Component	Kinetochore	IDA	17363900
GO:0003723	Function	RNA binding	IEA
GO:0005049	Function	Nuclear export signal receptor activity	IBA
GO:0005049	Function	Nuclear export signal receptor activity	IDA	29666234
GO:0005049	Function	Nuclear export signal receptor activity	IEA
GO:0005049	Function	Nuclear export signal receptor activity	IMP	12724356, 12773398
GO:0005049	Function	Nuclear export signal receptor activity	ISS	31340148
GO:0005049	Function	Nuclear export signal receptor activity	TAS
GO:0005515	Function	Protein binding	IPI	10358091, 10557333, 11000203, 11545741, 11932251, 12724356, 15161933, 16302269, 16314522, 16319068, 17099693, 17268548, 18952844, 19339969, 19339972, 19955415, 20485264, 20826784, 20921223, 21378169, 22022502, 22084111, 22250199, 22427340, 22500989, 22730302, 23850451, 24169621, 258
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	TAS	9368044
GO:0005642	Component	Annulate lamellae	IDA	12210765
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS	9368044
GO:0005730	Component	Nucleolus	IDA	23782956
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	23782956
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9368044
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006406	Process	MRNA export from nucleus	IEA
GO:0006406	Process	MRNA export from nucleus	ISS	31340148
GO:0006611	Process	Protein export from nucleus	IC	21378169
GO:0006611	Process	Protein export from nucleus	IDA	22250199, 29666234
GO:0006611	Process	Protein export from nucleus	IEA
GO:0006611	Process	Protein export from nucleus	IEA
GO:0006611	Process	Protein export from nucleus	IMP	22427340
GO:0006611	Process	Protein export from nucleus	IMP	12773398
GO:0006611	Process	Protein export from nucleus	IPI	29666234
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006913	Process	Nucleocytoplasmic transport	IMP	11000203
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010824	Process	Regulation of centrosome duplication	IEA
GO:0015030	Component	Cajal body	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0019904	Function	Protein domain specific binding	IEA
GO:0031267	Function	Small GTPase binding	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0032434	Process	Regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	29666234
GO:0032991	Component	Protein-containing complex	IDA	10557333, 29666234
GO:0034504	Process	Protein localization to nucleus	IEA
GO:0042176	Process	Regulation of protein catabolic process	IEA
GO:0042254	Process	Ribosome biogenesis	IMP	12724356
GO:0046825	Process	Regulation of protein export from nucleus	IEA
GO:0051028	Process	MRNA transport	IEA
GO:0071401	Process	Cellular response to triglyceride	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:1902075	Process	Cellular response to salt	IEA
GO:1990904	Component	Ribonucleoprotein complex	IDA	18809582

Other IDs

• MIM: 602559
• HGNC: 12825
• e!Ensembl: ENSG00000082898

Protein

• UniProt ID: O14980
• Protein name: Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog)
• Protein function: Mediates the nuclear export of cellular proteins (cargos) bearing a leucine-rich nuclear export signal (NES) and of RNAs. In the nucleus, in association with RANBP3, binds cooperatively to the NES on its target protein and to the GTPase RAN in i
• PDB: 1W9C , 2L1L , 3GB8 , 4BSM , 4BSN , 5DIS , 6TVO , 7B51 , 9B62
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03810	IBN_N	46 → 112	Importin-beta N-terminal domain	Family
  PF08389	Xpo1	123 → 268	Exportin 1-like protein	Family
  PF08767	CRM1_C	709 → 1027	CRM1 C terminal	Family
  PF18777	CRM1_repeat	345 → 381	Chromosome region maintenance or exportin repeat	Repeat
  PF18784	CRM1_repeat_2	405 → 472	CRM1 / Exportin repeat 2	Repeat
  PF18787	CRM1_repeat_3	485 → 535	CRM1 / Exportin repeat 3	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes. Not expressed in the kidney. {ECO:0000269|PubMed:9049309, ECO
• Sequence:

  MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAW
  TRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCV
  EKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFD
  FSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGY
  IFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPL
  NTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEV
  EETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLM
  VSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKL
  HNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAII
  ASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFV
  QVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLL
  PNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNV
  YKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPL
  LDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEE
  YPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTL
  LQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKIST
  SLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLV
  QIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD

• Sequence length: 1071

Pathways

KEGG Pathway	Reactome Pathway
Ribosome biogenesis in eukaryotes	Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Nucleocytoplasmic transport	Rev-mediated nuclear export of HIV RNA
Viral life cycle - HIV-1	NEP/NS2 Interacts with the Cellular Export Machinery
Influenza A	Separation of Sister Chromatids
Human T-cell leukemia virus 1 infection	Resolution of Sister Chromatid Cohesion
	Deactivation of the beta-catenin transactivating complex
	HuR (ELAVL1) binds and stabilizes mRNA
	RHO GTPases Activate Formins
	MAPK6/MAPK4 signaling
	Mitotic Prometaphase
	Cyclin A/B1/B2 associated events during G2/M transition
	Estrogen-dependent nuclear events downstream of ESR-membrane signaling
	EML4 and NUDC in mitotic spindle formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (8)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	29892015, 40050429, 40645996	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	37262302	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	38965376	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	37262302	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm	-	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	29610475	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizure	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
XPO1-associated Neurodevelopmental Disorder	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (162)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	23970380, 27780859		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	27211268		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	31088931		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	29765539		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	12070164, 15678162		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23970380, 27780859		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	28196522		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	27312795		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	16504563, 17360758		★☆☆☆☆ Found in Text Mining only
Aganglionosis, Colonic	Colonic Aganglionosis	BEFREE	28388555		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29545601		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	28852098		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24899509, 31831564		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35751199	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	21750575	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	21750575		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	21750575		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	21750575	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27312795, 27479820, 29501729, 31125526, 31789821		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	31753924		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	33054049	Associate	★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	31753924		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30349650		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27533791, 28761359, 29725458		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33117284	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11287420, 12861014, 39178254	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20546338, 24026662, 8250909		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31088931, 31371628, 33856525, 36791564, 39178254	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25629636, 27680702		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18306389, 21756326, 24018641, 26055813, 27649553, 27981892, 29155058		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	25137373	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	25137373	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29797792		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29797792		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	23970380, 27780859		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28882106		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28882106, 36200270	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22086416, 23034282, 27469216, 31710039		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15678162		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25996664		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25996664, 31870117	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23079374		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28286054		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	34321086	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	35468861	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27312795, 28196522		★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	31129760		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36589683	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24018641		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	28819023		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	LHGDN	15790592		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	29545601		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	36681091	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29866745, 30337641		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37712615	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29866745, 30337641		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19574837, 24018641		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	30814875		★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	36807877	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23034282, 28196522, 28314790, 28702009, 29203585, 31822399		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	34165175	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	11287420	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	27312795		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	27312795, 27479820, 29650799, 30108156, 31816062, 32079702	Associate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	31088931		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	36195086	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	28269752, 38031942	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23970380, 25027513		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24902788, 27114368, 27613868, 27634897, 31755865	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	16720834, 23564911, 25531824, 26438511, 31755865, 34446939, 35347147, 37047788, 37473530, 38019903, 38429501, 38608356	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22677130, 23564911, 25716206, 25891481, 26091065, 26438511, 27211268, 30596398, 31755865		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	27893412		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16216419, 16317707, 27013579		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25629636		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28373767	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	38031942	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31296529		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	31752970, 37801604	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28468797		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	31594826		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	30814875		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	22986101, 24766216, 30510142		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	30337641		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27533791, 28761359, 29725458		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24898882		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23079374		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	16317707, 31088931		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25629636, 27680702		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18306389, 21756326, 26055813, 27649553, 27981892, 29155058		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23089203, 24899509, 29137251, 29735942, 31382411		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23507703, 26549027, 30450161, 31018022		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29610475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24026662, 28373767, 30115935, 31088931, 31569391		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19574837, 21683812, 22677130, 23034282, 23079374, 24431073, 24739265, 24898882, 25148895, 25629636, 25996664, 26501108, 26576099, 27329820, 27649553, 27780859, 27893412, 28196522, 28388555, 28702009, 28761359, 28819023, 29725458, 29735942, 29973205, 30115935, 30321615, 30337641, 30349650, 30814875, 31088931, 31113936, 31285298, 31296529, 31429063, 31495993, 31822399		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	29729696		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29797792		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15678162		★☆☆☆☆ Found in Text Mining only
Malignant Uterine Corpus Neoplasm	Malignant Uterine Corpus Neoplasm	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27533791, 30987380		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	22986101, 24766216, 28388555, 30510142		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	ORPHANET_DG	27312795		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	30211726, 31789821		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22832492, 30108156	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23615632, 25057921		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	36807877	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36672210	Associate	★☆☆☆☆ Found in Text Mining only
Monoclonal B-Cell Lymphocytosis	B-Cell Lymphocytosis	BEFREE	27469216		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	23752175		★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	11593014	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	30590006		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19690141, 23752175, 26939700, 27806331, 28668761, 29610030, 31125526, 31433920, 31465861		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23588715, 35643867, 37964302	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	25573989		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31133853, 31768947		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	21637295	Associate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	21637295		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16103052, 19574837, 20826784, 22677130, 23034282, 23079374, 23089203, 23564911, 23615632, 24026662, 24431073, 24739265, 25148895, 25716206, 25996664, 26576099, 26939700, 27479820, 27533791, 27893412, 28000054, 28196522, 28336527, 28373767, 28819023, 29137251, 29381435, 29487219, 29725458, 29797792, 29973205, 30115935, 30118500, 30450161, 31052304, 31382411, 31433920, 31636097, 31793336, 31831564		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	35197448	Associate	★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	31628052		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24946002		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	19082467		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33856525	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	29155058		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18306389, 21756326, 26055813, 27649553, 27981892		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18306389, 26055813, 34898375	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23089203, 24899509, 29137251, 29735942, 31382411		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24899509, 31382411		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36200270	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	21750575		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	27780859		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	31305018		★☆☆☆☆ Found in Text Mining only
Primary mediastinal large B-cell lymphoma	Mediastinal B-Cell Lymphoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	31305018		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23507703, 26549027, 30450161, 31018022		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24391718, 25026284, 26549027, 31018022	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29610475		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal carcinoma	Renal Carcinoma	BEFREE	23079374		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23079374		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	28647672		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	36195086, 36370692	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	26918731, 28314790		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	33414399	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30064906		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	31129760		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29729696		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24898882, 25148895		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	39177040	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29950445		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24026662, 28373767, 30115935, 31088931, 31569391, 31619134		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28373767, 31088931, 31569391	Associate	★☆☆☆☆ Found in Text Mining only
Thymic epithelial tumor	Thymic tumor	BEFREE	28819023		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24431073		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19117056	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	27825468		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	36195086, 36370692	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

HSF2 2 shared evidence sourcesCTD (Atrial fibrillation), Disgenet (Atrial fibrillation) Related via 2 shared evidence sources. MYOZ1 2 shared evidence sourcesCTD (Atrial fibrillation), Disgenet (Atrial fibrillation) Related via 2 shared evidence sources. SNRNP27 2 shared evidence sourcesCTD (Atrial fibrillation), Disgenet (Atrial fibrillation) Related via 2 shared evidence sources. PSMB7 2 shared pathwaysSeparation of Sister Chromatids, MAPK6/MAPK4 signaling 2 shared evidence sourcesCTD (Atrial fibrillation), Disgenet (Atrial fibrillation) Related via 2 shared pathways including Separation of Sister Chromatids, MAPK6/MAPK4 signaling — evidence mostly CTD. CYTH1 2 shared evidence sourcesCTD (Atrial fibrillation), Disgenet (Atrial fibrillation) Related via 2 shared evidence sources.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
HSF2	0	[]	0	[]	2	["CTD (Atrial fibrillation)","Disgenet (Atrial fibrillation)"]
MYOZ1	0	[]	0	[]	2	["CTD (Atrial fibrillation)","Disgenet (Atrial fibrillation)"]
SNRNP27	0	[]	0	[]	2	["CTD (Atrial fibrillation)","Disgenet (Atrial fibrillation)"]
PSMB7	0	[]	2	["Separation of Sister Chromatids","MAPK6\/MAPK4 signaling"]	2	["CTD (Atrial fibrillation)","Disgenet (Atrial fibrillation)"]
CYTH1	0	[]	0	[]	2	["CTD (Atrial fibrillation)","Disgenet (Atrial fibrillation)"]

Diseases Linked via Similar Genes

Breast cancer Linked via 2 of 5 related genesHSF2, SNRNP27 Open angle glaucoma Linked via 1 of 5 related genesHSF2 Hypothyroidism Linked via 1 of 5 related genesPSMB7 Respiratory system disease Linked via 1 of 5 related genesPSMB7 Coronary artery disease Linked via 1 of 5 related genesCYTH1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Breast cancer	2	["HSF2","SNRNP27"]
Open angle glaucoma	1	["HSF2"]
Hypothyroidism	1	["PSMB7"]
Respiratory system disease	1	["PSMB7"]
Coronary artery disease	1	["CYTH1"]