FGF4 (fibroblast growth factor 4)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2249
• Gene name: Fibroblast growth factor 4
• Gene symbol: FGF4
• Synonyms (NCBI Gene): FGF-4, HBGF-4, HST, HST-1, HSTF-1, HSTF1, K-FGF, KFGF, SRTD22
• Chromosome: 11
• Chromosome location: 11q13.3
• Summary: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018466	hsa-miR-335-5p	Microarray	18185580
MIRT1995276	hsa-miR-129-5p	CLIP-seq
MIRT1995277	hsa-miR-2052	CLIP-seq
MIRT1995278	hsa-miR-571	CLIP-seq
MIRT1995279	hsa-miR-759	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NANOG	Activation	22378194
POU5F1	Activation	10801796
SOX2	Activation	10801796

Gene ontology (GO) Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001502	Process	Cartilage condensation	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	2959959
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	TAS	2959959
GO:0007267	Process	Cell-cell signaling	TAS	2959959
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	2959959
GO:0008201	Function	Heparin binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	8663044
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	2959959
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	8663044
GO:0010463	Process	Mesenchymal cell proliferation	IDA	11023873
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0019827	Process	Stem cell population maintenance	IEA
GO:0022008	Process	Neurogenesis	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035116	Process	Embryonic hindlimb morphogenesis	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060363	Process	Cranial suture morphogenesis	IEA
GO:0060561	Process	Apoptotic process involved in morphogenesis	IEA
GO:0060591	Process	Chondroblast differentiation	IDA	17167778
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	17167778
GO:0072089	Process	Stem cell proliferation	IEA
GO:1904019	Process	Epithelial cell apoptotic process	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000544	Process	Regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	16756958
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA

Other IDs

• MIM: 164980
• HGNC: 3682
• e!Ensembl: ENSG00000075388

Protein

• UniProt ID: P08620
• Protein name: Fibroblast growth factor 4 (FGF-4) (Heparin secretory-transforming protein 1) (HST) (HST-1) (HSTF-1) (Heparin-binding growth factor 4) (HBGF-4) (Transforming protein KS3)
• Protein function: Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis. May play a role in embryonic molar tooth bud developme
• PDB: 1IJT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00167	FGF	82 → 203	Fibroblast growth factor	Domain

• Sequence:

  MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPV
  AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP
  VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIA
  LSKNGKTKKGNRVSPTMKVTHFLPRL

• Sequence length: 206

Pathways

KEGG Pathway	Reactome Pathway
MAPK signaling pathway	PI3K Cascade
Ras signaling pathway	PIP3 activates AKT signaling
Rap1 signaling pathway	Signaling by activated point mutants of FGFR1
Calcium signaling pathway	Signaling by activated point mutants of FGFR3
PI3K-Akt signaling pathway	FGFR4 ligand binding and activation
Regulation of actin cytoskeleton	FGFR3c ligand binding and activation
Pathways in cancer	FGFR1c ligand binding and activation
Chemical carcinogenesis - receptor activation	FGFR2c ligand binding and activation
Melanoma	FGFR3 mutant receptor activation
Breast cancer	Activated point mutants of FGFR2
Gastric cancer	Constitutive Signaling by Aberrant PI3K in Cancer
	Phospholipase C-mediated cascade: FGFR1
	Phospholipase C-mediated cascade; FGFR2
	Phospholipase C-mediated cascade; FGFR3
	Phospholipase C-mediated cascade; FGFR4
	Downstream signaling of activated FGFR1
	SHC-mediated cascade:FGFR1
	PI-3K cascade:FGFR1
	FRS-mediated FGFR1 signaling
	PI-3K cascade:FGFR2
	SHC-mediated cascade:FGFR2
	FRS-mediated FGFR2 signaling
	SHC-mediated cascade:FGFR3
	FRS-mediated FGFR3 signaling
	PI-3K cascade:FGFR3
	FRS-mediated FGFR4 signaling
	SHC-mediated cascade:FGFR4
	PI-3K cascade:FGFR4
	Negative regulation of FGFR1 signaling
	Negative regulation of FGFR2 signaling
	Negative regulation of FGFR3 signaling
	Negative regulation of FGFR4 signaling
	Signaling by FGFR2 in disease
	Signaling by FGFR1 in disease
	FGFRL1 modulation of FGFR1 signaling
	RAF/MAP kinase cascade
	PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
	Signaling by FGFR3 point mutants in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (6)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BREAST NEOPLASMS	—	CTD	21936542	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	25822088	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thoracic dysostosis, isolated	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THORACIC MALFORMATION	—	Disgenet, GenCC Disgenet, GenCC	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	21980299	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	21980299	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (84)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	3030292		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27677589		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	8100831		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	2474139, 8622895		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12429977, 12841847, 1826346, 18592003, 2071147, 2181375, 2474139, 2677918, 8481921, 8758927, 9184170		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	21936542		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12841847, 1989653, 24811890	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	12841847	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	2071147, 2098274, 2181375, 2529025, 3136110, 8010723		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	14648664, 8622895		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26943773	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28445152	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11764380		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	3108211		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	2529025, 29802489, 3136110		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33779485	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11909005		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16454656		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	34685725	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	17632770, 24120895		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31373395		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	8685603		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	16681770, 8685603	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	3136110, 7796011, 8010723, 8523818		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	1533816		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	3133332, 3136110, 8509434	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18405350, 21734802, 29866946, 3136110, 33725708, 34962019	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	31155838		★☆☆☆☆ Found in Text Mining only
Fanconi-Bickel Syndrome	Fanconi-Bickel Syndrome	BEFREE	28944920		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28382720		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	30887595, 31666694		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	30887595, 33199729	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	11764380, 1706218, 9715278		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30240193		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11909005		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34685725	Associate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10786811		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	3133332	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	2895649, 9050999		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12163055		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22890726, 2824415, 2856253, 30698907		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	25822088		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	2824415		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	3133332	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12429977, 12841847, 1826346, 2474139, 8481921, 9184170		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	21936542		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	8685603		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	1533816, 7796011		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	2895649, 2953031, 3108211, 3290903		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	14648664, 8622895		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10557081, 11146552, 22890726, 25329002, 27693927, 30240193, 3290903, 9715278		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	3108211		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	21936542		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12841847		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	21936542		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	8962718, 9366526		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	21936542		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30240193		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	30240193		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	7994085		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	34685725	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	16454656, 23863927		★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	15942670		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11146552, 11568558, 14499691, 1706218, 1826346, 18592003, 1964794, 2011398, 2177639, 2181375, 29277815, 8010723, 8481920, 8523818, 8622895, 9715278, 9846989		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	23863927		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	27267848		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	8946196		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	17287403, 8550832		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	9715278		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	28041965		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	9715278		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	1706218, 21649665		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	31400091		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	1997190, 3136110, 8010723, 9268987		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17487429, 1997190, 27974698, 29936056		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	11901038, 18555186		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17390055, 2895649, 2953031		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	31215272		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29866946, 34551773	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	3133332	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34951738	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

FGF8 47 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Regulation of actin cytoskeleton, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer, PIP3 activates AKT signaling, RAF/MAP kinase cascade, Constitutive Signaling by Aberrant PI3K in Cancer +35 more Related via 47 shared pathways including MAPK signaling pathway, Ras signaling pathway. FGF17 47 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Regulation of actin cytoskeleton, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer, PIP3 activates AKT signaling, RAF/MAP kinase cascade, Constitutive Signaling by Aberrant PI3K in Cancer +35 more Related via 47 shared pathways including MAPK signaling pathway, Ras signaling pathway. FGF9 46 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Regulation of actin cytoskeleton, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer, PIP3 activates AKT signaling, RAF/MAP kinase cascade, Constitutive Signaling by Aberrant PI3K in Cancer +34 more Related via 46 shared pathways including MAPK signaling pathway, Ras signaling pathway. FGF20 46 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Regulation of actin cytoskeleton, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer, PIP3 activates AKT signaling, RAF/MAP kinase cascade, Constitutive Signaling by Aberrant PI3K in Cancer +34 more Related via 46 shared pathways including MAPK signaling pathway, Ras signaling pathway. FGF23 46 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Regulation of actin cytoskeleton, Melanoma, Breast cancer, Gastric cancer, PIP3 activates AKT signaling, RAF/MAP kinase cascade, Constitutive Signaling by Aberrant PI3K in Cancer, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling +34 more Related via 46 shared pathways including MAPK signaling pathway, Ras signaling pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FGF8	0	[]	47	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Chemical carcinogenesis - receptor activation","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer"]	0	[]
FGF17	0	[]	47	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Chemical carcinogenesis - receptor activation","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer"]	0	[]
FGF9	0	[]	46	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Chemical carcinogenesis - receptor activation","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer"]	0	[]
FGF20	0	[]	46	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Chemical carcinogenesis - receptor activation","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer"]	0	[]
FGF23	0	[]	46	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer","PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling"]	0	[]

Diseases Linked via Similar Genes

Desbuquois syndrome Linked via 3 of 5 related genesFGF8, FGF9, FGF23 Cleft lip Linked via 2 of 5 related genesFGF8, FGF9 Cleft palate Linked via 2 of 5 related genesFGF8, FGF9 Complete unilateral cleft lip Linked via 2 of 5 related genesFGF8, FGF9 Hypogonadotropic hypogonadism Linked via 2 of 5 related genesFGF8, FGF17

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Desbuquois syndrome	3	["FGF8","FGF9","FGF23"]
Cleft lip	2	["FGF8","FGF9"]
Cleft palate	2	["FGF8","FGF9"]
Complete unilateral cleft lip	2	["FGF8","FGF9"]
Hypogonadotropic hypogonadism	2	["FGF8","FGF17"]