FGF22 (fibroblast growth factor 22)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 27006
Gene name Fibroblast growth factor 22
Gene symbol FGF22
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19p13.3
Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT021791 hsa-miR-132-3p Microarray 17612493
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22 Show/Hide all (22)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005104 Function Fibroblast growth factor receptor binding IBA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space NAS 11342227
GO:0005730 Component Nucleolus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
605831 3679 ENSG00000070388
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HCT0
Protein name Fibroblast growth factor 22 (FGF-22)
Protein function Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in vitro). May be involved in hair development.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00167 FGF 41 → 165 Fibroblast growth factor Domain
Sequence 
MRRRLWLGLAWLLLARAPDAAGTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGR
VQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIE
ENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS
Sequence length 170
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
MAPK signaling pathway PI3K Cascade
Ras signaling pathway PIP3 activates AKT signaling
Rap1 signaling pathway FGFR1b ligand binding and activation
Calcium signaling pathway FGFR2b ligand binding and activation
PI3K-Akt signaling pathway Activated point mutants of FGFR2
Regulation of actin cytoskeleton Constitutive Signaling by Aberrant PI3K in Cancer
Pathways in cancer Phospholipase C-mediated cascade: FGFR1
Chemical carcinogenesis - receptor activation Phospholipase C-mediated cascade; FGFR2
Melanoma Downstream signaling of activated FGFR1
Breast cancer SHC-mediated cascade:FGFR1
Gastric cancer PI-3K cascade:FGFR1
  FRS-mediated FGFR1 signaling
  PI-3K cascade:FGFR2
  SHC-mediated cascade:FGFR2
  FRS-mediated FGFR2 signaling
  Negative regulation of FGFR1 signaling
  Negative regulation of FGFR2 signaling
  Signaling by FGFR2 in disease
  FGFRL1 modulation of FGFR1 signaling
  RAF/MAP kinase cascade
  PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Sort by:
FGF3 30 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Regulation of actin cytoskeleton, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer, PIP3 activates AKT signaling, RAF/MAP kinase cascade, Constitutive Signaling by Aberrant PI3K in Cancer +18 more Related via 30 shared pathways including MAPK signaling pathway, Ras signaling pathway. FGF10 30 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Regulation of actin cytoskeleton, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer, PIP3 activates AKT signaling, RAF/MAP kinase cascade, Constitutive Signaling by Aberrant PI3K in Cancer +18 more Related via 30 shared pathways including MAPK signaling pathway, Ras signaling pathway. FGF7 22 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Regulation of actin cytoskeleton, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer, PIP3 activates AKT signaling, RAF/MAP kinase cascade, Constitutive Signaling by Aberrant PI3K in Cancer +10 more Related via 22 shared pathways including MAPK signaling pathway, Ras signaling pathway. FGF6 27 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Regulation of actin cytoskeleton, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer, PIP3 activates AKT signaling, RAF/MAP kinase cascade, Constitutive Signaling by Aberrant PI3K in Cancer +15 more Related via 27 shared pathways including MAPK signaling pathway, Ras signaling pathway. FGF5 28 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Regulation of actin cytoskeleton, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer, PIP3 activates AKT signaling, RAF/MAP kinase cascade, Constitutive Signaling by Aberrant PI3K in Cancer +16 more Related via 28 shared pathways including MAPK signaling pathway, Ras signaling pathway.
Cleft lip Linked via 3 of 5 related genesFGF3, FGF10, FGF7 Cleft palate Linked via 3 of 5 related genesFGF3, FGF10, FGF7 Complete unilateral cleft lip Linked via 3 of 5 related genesFGF3, FGF10, FGF7 Breast neoplasms Linked via 2 of 5 related genesFGF3, FGF10 Diabetes mellitus type 2 Linked via 2 of 5 related genesFGF3, FGF6