FBXO5 (F-box protein 5)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 26271
• Gene name: F-box protein 5
• Gene symbol: FBXO5
• Synonyms (NCBI Gene): EMI1, FBX5, Fbxo31
• Chromosome: 6
• Chromosome location: 6q25.2
• Summary: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box

miRNA Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016524	hsa-miR-193b-3p	Microarray	20304954
MIRT019510	hsa-miR-151a-3p	Sequencing	20371350
MIRT024627	hsa-miR-215-5p	Microarray	19074876
MIRT026894	hsa-miR-192-5p	Microarray	19074876
MIRT030275	hsa-miR-26b-5p	Microarray	19088304
MIRT992903	hsa-miR-520d-5p	CLIP-seq
MIRT992904	hsa-miR-524-5p	CLIP-seq
MIRT992905	hsa-miR-570	CLIP-seq
MIRT992906	hsa-miR-208a	CLIP-seq
MIRT992907	hsa-miR-208b	CLIP-seq
MIRT992908	hsa-miR-3658	CLIP-seq
MIRT992909	hsa-miR-4282	CLIP-seq
MIRT992910	hsa-miR-4432	CLIP-seq
MIRT992911	hsa-miR-499-5p	CLIP-seq
MIRT992912	hsa-miR-629	CLIP-seq
MIRT1994474	hsa-miR-383	CLIP-seq
MIRT1994475	hsa-miR-433	CLIP-seq
MIRT1994476	hsa-miR-4772-5p	CLIP-seq
MIRT1994477	hsa-miR-802	CLIP-seq

Gene ontology (GO) Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001556	Process	Oocyte maturation	IEA
GO:0005515	Function	Protein binding	IPI	11988738, 12791267, 16439210, 16921029, 17380122, 17719540, 18662541, 23708001, 26083744, 27705803, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11988738
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	11988738
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IDA	15469984
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006275	Process	Regulation of DNA replication	IMP	17234884, 17485488
GO:0006974	Process	DNA damage response	IMP	17875940
GO:0007057	Process	Spindle assembly involved in female meiosis I	IEA
GO:0007088	Process	Regulation of mitotic nuclear division	IBA
GO:0007088	Process	Regulation of mitotic nuclear division	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	ISS
GO:0008270	Function	Zinc ion binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	17234884
GO:0010948	Process	Negative regulation of cell cycle process	IEA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IMP	17485488
GO:0010997	Function	Anaphase-promoting complex binding	IDA	16921029, 26083744
GO:0016050	Process	Vesicle organization	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019901	Function	Protein kinase binding	IPI	15148369
GO:0032876	Process	Negative regulation of DNA endoreduplication	IMP	17875940
GO:0040020	Process	Regulation of meiotic nuclear division	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IMP	29850565
GO:0045835	Process	Negative regulation of meiotic nuclear division	IBA
GO:0045835	Process	Negative regulation of meiotic nuclear division	IEA
GO:0045835	Process	Negative regulation of meiotic nuclear division	IEA
GO:0045841	Process	Negative regulation of mitotic metaphase/anaphase transition	IDA	11988738, 16921029
GO:0046785	Process	Microtubule polymerization	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051225	Process	Spindle assembly	IEA
GO:0051301	Process	Cell division	IEA
GO:0051444	Process	Negative regulation of ubiquitin-protein transferase activity	IDA	23708001
GO:0070169	Process	Positive regulation of biomineral tissue development	IMP	29850565
GO:0072687	Component	Meiotic spindle	IEA
GO:0072687	Component	Meiotic spindle	ISS
GO:0140678	Function	Molecular function inhibitor activity	IDA	23708605
GO:0140678	Function	Molecular function inhibitor activity	IMP	23708605
GO:1904667	Process	Negative regulation of ubiquitin protein ligase activity	IDA	11988738, 16921029
GO:1904667	Process	Negative regulation of ubiquitin protein ligase activity	IMP	23708605, 29875408
GO:1905322	Process	Positive regulation of mesenchymal stem cell migration	IMP	29850565
GO:1990948	Function	Ubiquitin ligase inhibitor activity	IDA	15148369
GO:2000773	Process	Negative regulation of cellular senescence	IMP	17875940

Other IDs

• MIM: 606013
• HGNC: 13584
• e!Ensembl: ENSG00000112029

Protein

• UniProt ID: Q9UKT4
• Protein name: F-box only protein 5 (Early mitotic inhibitor 1)
• Protein function: Regulator of APC activity during mitotic and meiotic cell cycle (PubMed:16921029, PubMed:17234884, PubMed:17485488, PubMed:17875940, PubMed:23708001, PubMed:23708605). During mitotic cell cycle plays a role as both substrate and inhibitor of APC
• PDB: 2M6N , 4UI9 , 9GAW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00646	F-box	242 → 295	F-box domain	Domain

• Sequence:

  MSRRPCSCALRPPRCSCSASPSAVTAAGRPRPSDSCKEESSTLSVKMKCDFNCNHVHSGL
  KLVKPDDIGRLVSYTPAYLEGSCKDCIKDYERLSCIGSPIVSPRIVQLETESKRLHNKEN
  QHVQQTLNSTNEIEALETSRLYEDSGYSSFSLQSGLSEHEEGSLLEENFGDSLQSCLLQI
  QSPDQYPNKNLLPVLHFEKVVCSTLKKNAKRNPKVDREMLKEIIARGNFRLQNIIGRKMG
  LECVDILSELFRRGLRHVLATILAQLSDMDLINVSKVSTTWKKILEDDKGAFQLYSKAIQ
  RVTENNNKFSPHASTREYVMFRTPLASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHN
  EFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCS
  DGKLLKASCKIGPLPGTKKSKKNLRRL

• Sequence length: 447

Pathways

KEGG Pathway	Reactome Pathway
Cell cycle	SCF-beta-TrCP mediated degradation of Emi1
Oocyte meiosis	Regulation of APC/C activators between G1/S and early anaphase
	Phosphorylation of Emi1
	Mitotic Metaphase/Anaphase Transition
	G1/S-Specific Transcription

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (20)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	24277465, 30341246		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38041032	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	27065322		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32229735	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	31705877	Associate	★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	21670593	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38212299	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31958024	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37168048	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	27065322		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22995332, 29805683		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37168048	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24277465, 30341246		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25559288		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18204430		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18204430	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29728763		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37121410	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30554948		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29246203	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SMC1B 2 shared pathwaysCell cycle, Oocyte meiosis Related via 2 shared pathways including Cell cycle, Oocyte meiosis. PTTG2 2 shared pathwaysCell cycle, Oocyte meiosis Related via 2 shared pathways including Cell cycle, Oocyte meiosis. FZR1 4 shared pathwaysCell cycle, Regulation of APC/C activators between G1/S and early anaphase, SCF-beta-TrCP mediated degradation of Emi1, Phosphorylation of Emi1 Related via 4 shared pathways including Cell cycle, Regulation of APC/C activators between G1/S and early anaphase. CDC45 2 shared pathwaysCell cycle, G1/S-Specific Transcription Related via 2 shared pathways including Cell cycle, G1/S-Specific Transcription. ESPL1 2 shared pathwaysCell cycle, Oocyte meiosis Related via 2 shared pathways including Cell cycle, Oocyte meiosis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SMC1B	0	[]	2	["Cell cycle","Oocyte meiosis"]	0	[]
PTTG2	0	[]	2	["Cell cycle","Oocyte meiosis"]	0	[]
FZR1	0	[]	4	["Cell cycle","Regulation of APC\/C activators between G1\/S and early anaphase","SCF-beta-TrCP mediated degradation of Emi1","Phosphorylation of Emi1"]	0	[]
CDC45	0	[]	2	["Cell cycle","G1\/S-Specific Transcription"]	0	[]
ESPL1	0	[]	2	["Cell cycle","Oocyte meiosis"]	0	[]

Diseases Linked via Similar Genes

Urinary bladder neoplasms Linked via 2 of 5 related genesSMC1B, ESPL1 Colorectal cancer Linked via 1 of 5 related genesSMC1B Gonadal dysgenesis Linked via 1 of 5 related genesSMC1B Rheumatoid arthritis Linked via 1 of 5 related genesSMC1B Autism Linked via 1 of 5 related genesFZR1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Urinary bladder neoplasms	2	["SMC1B","ESPL1"]
Colorectal cancer	1	["SMC1B"]
Gonadal dysgenesis	1	["SMC1B"]
Rheumatoid arthritis	1	["SMC1B"]
Autism	1	["FZR1"]