PTTG2 (pituitary tumor-transforming 2)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 10744
Gene name Pituitary tumor-transforming 2
Gene symbol PTTG2
Synonyms (NCBI Gene)
-
Chromosome 4
Chromosome location 4p14
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0017124 Function SH3 domain binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604231 9691 ENSG00000250254
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NZH5
Protein name Securin-2 (Pituitary tumor-transforming gene 2 protein)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04856 Securin 1 → 191 Securin sister-chromatid separation inhibitor Family
Tissue specificity TISSUE SPECIFICITY: Expressed at low levels in the pituitary, liver, spleen, prostate, testis, ovary, small intestine and colon. Also expressed in various pituitary, testicular, liver and ovarian tumors. {ECO:0000269|PubMed:10084610, ECO:0000269|PubMed:10
Sequence 
MATLIYVDKEIGEPGTRVAAKDVLKLESRPSIKALDGISQVLTRRFGKTYDAPSALPKAT
RKALGTVNRATEKSVKTNGPRKQKQPSFSAKKMTEKTVKTKSSVPASDDAYPEIEKFFPF
NLLDFESFDLPEERQIAHLPLSGVPLMILDEEGELEKLFQLGPPSPVKMPSPPWECNLLQ
SPSSILSTLDVELPAVCYDIDI
Sequence length 202
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Cell cycle
Oocyte meiosis
Human T-cell leukemia virus 1 infection
Sort by:
ESPL1 3 shared pathwaysCell cycle, Oocyte meiosis, Human T-cell leukemia virus 1 infection Related via 3 shared pathways including Cell cycle, Oocyte meiosis. SMC1B 2 shared pathwaysCell cycle, Oocyte meiosis Related via 2 shared pathways including Cell cycle, Oocyte meiosis. ANAPC13 3 shared pathwaysCell cycle, Oocyte meiosis, Human T-cell leukemia virus 1 infection Related via 3 shared pathways including Cell cycle, Oocyte meiosis. PTTG1 3 shared pathwaysCell cycle, Oocyte meiosis, Human T-cell leukemia virus 1 infection Related via 3 shared pathways including Cell cycle, Oocyte meiosis. PKMYT1 2 shared pathwaysCell cycle, Oocyte meiosis Related via 2 shared pathways including Cell cycle, Oocyte meiosis.
Urinary bladder neoplasms Linked via 2 of 5 related genesESPL1, SMC1B Hepatocellular carcinoma Linked via 2 of 5 related genesPTTG1, PKMYT1 Adenoid cystic carcinoma Linked via 1 of 5 related genesESPL1 Transitional cell carcinoma Linked via 1 of 5 related genesESPL1 Salivary gland neoplasms Linked via 1 of 5 related genesESPL1