FBXO2 (F-box protein 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 26232
• Gene name: F-box protein 2
• Gene symbol: FBXO2
• Synonyms (NCBI Gene): FBG1, FBX2, Fbs1, NFB42, OCP1
• Chromosome: 1
• Chromosome location: 1p36.22
• Summary: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box

miRNA Show/Hide all (59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT663455	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT663456	hsa-miR-1323	HITS-CLIP	23824327
MIRT663454	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT663453	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT663452	hsa-miR-6798-5p	HITS-CLIP	23824327
MIRT663451	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT663450	hsa-miR-1266-5p	HITS-CLIP	23824327
MIRT663449	hsa-miR-4518	HITS-CLIP	23824327
MIRT663448	hsa-miR-4469	HITS-CLIP	23824327
MIRT663447	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT663446	hsa-miR-4287	HITS-CLIP	23824327
MIRT663445	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT663444	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT663443	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT663441	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT663442	hsa-miR-767-3p	HITS-CLIP	23824327
MIRT663440	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT663438	hsa-miR-5189-3p	HITS-CLIP	23824327
MIRT663439	hsa-miR-3934-3p	HITS-CLIP	23824327
MIRT663437	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT663436	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT663435	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT663434	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT663455	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT663456	hsa-miR-1323	HITS-CLIP	23824327
MIRT663454	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT663453	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT663452	hsa-miR-6798-5p	HITS-CLIP	23824327
MIRT663451	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT663450	hsa-miR-1266-5p	HITS-CLIP	23824327
MIRT663449	hsa-miR-4518	HITS-CLIP	23824327
MIRT663448	hsa-miR-4469	HITS-CLIP	23824327
MIRT663447	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT663446	hsa-miR-4287	HITS-CLIP	23824327
MIRT663445	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT663444	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT663443	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT663441	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT663442	hsa-miR-767-3p	HITS-CLIP	23824327
MIRT663440	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT663438	hsa-miR-5189-3p	HITS-CLIP	23824327
MIRT663439	hsa-miR-3934-3p	HITS-CLIP	23824327
MIRT663437	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT663436	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT663435	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT663434	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT1994062	hsa-miR-1207-3p	CLIP-seq
MIRT1994063	hsa-miR-1275	CLIP-seq
MIRT1994064	hsa-miR-3175	CLIP-seq
MIRT1994065	hsa-miR-4514	CLIP-seq
MIRT1994066	hsa-miR-4525	CLIP-seq
MIRT1994067	hsa-miR-4645-5p	CLIP-seq
MIRT1994068	hsa-miR-4665-5p	CLIP-seq
MIRT1994069	hsa-miR-4673	CLIP-seq
MIRT1994070	hsa-miR-4692	CLIP-seq
MIRT1994071	hsa-miR-4723-5p	CLIP-seq
MIRT1994072	hsa-miR-4731-5p	CLIP-seq
MIRT1994073	hsa-miR-625	CLIP-seq
MIRT1994074	hsa-miR-637	CLIP-seq

Gene ontology (GO) Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS	10531035
GO:0005515	Function	Protein binding	IPI	25416956, 27705803, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21378169
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	TAS	10531035
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006516	Process	Glycoprotein catabolic process	IBA
GO:0006516	Process	Glycoprotein catabolic process	IEA
GO:0006516	Process	Glycoprotein catabolic process	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	ISS
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0019005	Component	SCF ubiquitin ligase complex	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	ISS
GO:0030246	Function	Carbohydrate binding	IEA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	ISS
GO:0031249	Function	Denatured protein binding	IEA
GO:0031396	Process	Regulation of protein ubiquitination	IEA
GO:0036211	Process	Protein modification process	TAS	10531035
GO:0036503	Process	ERAD pathway	IBA
GO:0036503	Process	ERAD pathway	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0098890	Component	Extrinsic component of postsynaptic membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099576	Process	Regulation of protein catabolic process at postsynapse, modulating synaptic transmission	IEA

Other IDs

• MIM: 607112
• HGNC: 13581
• e!Ensembl: ENSG00000116661

Protein

• UniProt ID: Q9UK22
• Protein name: F-box only protein 2
• Protein function: Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Involved in the endoplasmic reticulum-associated d
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04300	FBA	114 → 294	F-box associated region	Family
  PF12937	F-box-like	47 → 92	F-box-like	Domain

• Sequence:

  MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLA
  ALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRR
  RNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQ
  VIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVA
  VPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP

• Sequence length: 296

Pathways

KEGG Pathway	Reactome Pathway
Ubiquitin mediated proteolysis	Neddylation
Protein processing in endoplasmic reticulum	Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (8)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Familial cancer of breast	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FBXO2-related disorder	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (7)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Hyperglycemia	Hyperglycemia	BEFREE	27932386		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35409356	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29269301		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28341977		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	28341977	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23044167		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29269301		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

UBE4B 2 shared pathwaysUbiquitin mediated proteolysis, Protein processing in endoplasmic reticulum Related via 2 shared pathways including Ubiquitin mediated proteolysis, Protein processing in endoplasmic reticulum. UBE2F 2 shared pathwaysUbiquitin mediated proteolysis, Neddylation Related via 2 shared pathways including Ubiquitin mediated proteolysis, Neddylation. FBXW8 2 shared pathwaysUbiquitin mediated proteolysis, Neddylation Related via 2 shared pathways including Ubiquitin mediated proteolysis, Neddylation. FBXO4 2 shared pathwaysUbiquitin mediated proteolysis, Neddylation Related via 2 shared pathways including Ubiquitin mediated proteolysis, Neddylation. KLHL9 2 shared pathwaysUbiquitin mediated proteolysis, Neddylation Related via 2 shared pathways including Ubiquitin mediated proteolysis, Neddylation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
UBE4B	0	[]	2	["Ubiquitin mediated proteolysis","Protein processing in endoplasmic reticulum"]	0	[]
UBE2F	0	[]	2	["Ubiquitin mediated proteolysis","Neddylation"]	0	[]
FBXW8	0	[]	2	["Ubiquitin mediated proteolysis","Neddylation"]	0	[]
FBXO4	0	[]	2	["Ubiquitin mediated proteolysis","Neddylation"]	0	[]
KLHL9	0	[]	2	["Ubiquitin mediated proteolysis","Neddylation"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 2 of 5 related genesUBE4B, UBE2F 1p36 deletion syndrome Linked via 1 of 5 related genesUBE4B Atrial fibrillation Linked via 1 of 5 related genesUBE4B Atrial flutter Linked via 1 of 5 related genesUBE4B Brain injuries Linked via 1 of 5 related genesUBE4B

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	2	["UBE4B","UBE2F"]
1p36 deletion syndrome	1	["UBE4B"]
Atrial fibrillation	1	["UBE4B"]
Atrial flutter	1	["UBE4B"]
Brain injuries	1	["UBE4B"]