DYNLRB2 (dynein light chain roadblock-type 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 83657
Gene name Dynein light chain roadblock-type 2
Gene symbol DYNLRB2
Synonyms (NCBI Gene)
DNCL2BDNLC2BROBLD2
Chromosome 16
Chromosome location 16q23.2
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018162 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18 Show/Hide all (18)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003777 Function Microtubule motor activity NAS 11750132
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IBA
GO:0005856 Component Cytoskeleton IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607168 15467 ENSG00000168589
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TF09
Protein name Dynein light chain roadblock-type 2 (Dynein light chain 2B, cytoplasmic) (Roadblock domain-containing protein 2)
Protein function Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor
PDB 8J07
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03259 Robl_LC7 3 → 93 Roadblock/LC7 domain Domain
Tissue specificity TISSUE SPECIFICITY: High expression in heart, brain, placenta, skeletal muscle, prostate and small intestine; moderate in kidney, pancreas, spleen, testis, ovary and colon; low in lung, liver, thymus and leukocyte.
Sequence 
MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDI
DPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCE
Sequence length 96
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Motor proteins Intraflagellar transport
Salmonella infection  
Sort by:
DYNLRB1 3 shared pathwaysMotor proteins, Salmonella infection, Intraflagellar transport Related via 3 shared pathways including Motor proteins, Salmonella infection. DYNC2LI1 3 shared pathwaysMotor proteins, Salmonella infection, Intraflagellar transport Related via 3 shared pathways including Motor proteins, Salmonella infection. KIF17 2 shared pathwaysMotor proteins, Intraflagellar transport Related via 2 shared pathways including Motor proteins, Intraflagellar transport. DYNLT3 2 shared pathwaysMotor proteins, Salmonella infection Related via 2 shared pathways including Motor proteins, Salmonella infection. DYNLT1 2 shared pathwaysMotor proteins, Salmonella infection Related via 2 shared pathways including Motor proteins, Salmonella infection.
Bipolar disorder Linked via 1 of 5 related genesDYNLRB1 Jeune syndrome Linked via 1 of 5 related genesDYNC2LI1 Cholecystolithiasis Linked via 1 of 5 related genesDYNC2LI1 Kidney disease Linked via 1 of 5 related genesDYNC2LI1 Desbuquois syndrome Linked via 1 of 5 related genesDYNC2LI1