Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1780
Gene name	Dynein cytoplasmic 1 intermediate chain 1
Gene symbol	DYNC1I1
Synonyms (NCBI Gene)	DNCI1DNCIC1
Chromosome	7
Chromosome location	7q21.3

13 Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016726	hsa-miR-335-5p	Microarray	18185580
MIRT948807	hsa-miR-155	CLIP-seq
MIRT948808	hsa-miR-3160-5p	CLIP-seq
MIRT948809	hsa-miR-3671	CLIP-seq
MIRT948810	hsa-miR-4729	CLIP-seq
MIRT948811	hsa-miR-607	CLIP-seq
MIRT2216245	hsa-miR-1264	CLIP-seq
MIRT2216246	hsa-miR-1291	CLIP-seq
MIRT2216247	hsa-miR-146b-3p	CLIP-seq
MIRT2216248	hsa-miR-328	CLIP-seq
MIRT2216249	hsa-miR-4517	CLIP-seq
MIRT2216250	hsa-miR-486-5p	CLIP-seq
MIRT2216251	hsa-miR-9	CLIP-seq

32 Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IDA	19229290
GO:0000776	Component	Kinetochore	IEA
GO:0000922	Component	Spindle pole	IDA	19229290
GO:0000922	Component	Spindle pole	IEA
GO:0003774	Function	Cytoskeletal motor activity	TAS	10049579
GO:0003777	Function	Microtubule motor activity	ISS
GO:0005515	Function	Protein binding	IPI	14985359, 16189514, 19927128, 21900206, 23664119, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	25540360
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	25540360
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005868	Component	Cytoplasmic dynein complex	IBA
GO:0005868	Component	Cytoplasmic dynein complex	IEA
GO:0005868	Component	Cytoplasmic dynein complex	ISS
GO:0005868	Component	Cytoplasmic dynein complex	TAS	10049579
GO:0005874	Component	Microtubule	IEA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0008017	Function	Microtubule binding	ISS
GO:0010970	Process	Transport along microtubule	IBA
GO:0030286	Component	Dynein complex	IEA
GO:0030507	Function	Spectrin binding	IDA	23704327
GO:0031982	Component	Vesicle	IDA	20682791
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0045503	Function	Dynein light chain binding	IBA
GO:0045504	Function	Dynein heavy chain binding	IBA
GO:0047496	Process	Vesicle transport along microtubule	IMP	24561039
GO:0047496	Process	Vesicle transport along microtubule	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0055037	Component	Recycling endosome	IDA	24561039

MIM	HGNC	e!Ensembl
603772	2963	ENSG00000158560

O14576

Protein name

Cytoplasmic dynein 1 intermediate chain 1 (Cytoplasmic dynein intermediate chain 1) (Dynein intermediate chain 1, cytosolic) (DH IC-1)

Protein function

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	476 → 518	WD domain, G-beta repeat	Repeat
PF11540	Dynein_IC2	143 → 173	Cytoplasmic dynein 1 intermediate chain 2	Family

Sequence

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETE
ALLQSIGISPEPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPL
TRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSE
EDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRTIRV
IERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYP
ELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGT
YSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSL
DMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVF
EGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMW
SPVHPALFACVDGMGRLDLWNLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEG
RIWVYDVGELAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA

Sequence length

645

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Phagosome	Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Motor proteins	MHC class II antigen presentation
Vasopressin-regulated water reabsorption	Separation of Sister Chromatids
Salmonella infection	Resolution of Sister Chromatid Cohesion
	HSP90 chaperone cycle for steroid hormone receptors (SHR)
	RHO GTPases Activate Formins
	COPI-mediated anterograde transport
	COPI-independent Golgi-to-ER retrograde traffic
	Mitotic Prometaphase
	HCMV Early Events
	Aggrephagy
	EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (18)
Adrenocortical carcinoma, hereditary	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER'S DISEASE NEUROPATHOLOGIC CHANGE	—	GWAS catalog	25188341	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	25188341	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYNC1I1-related disorder	Likely benign; Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	41233554	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	30664745, 36411363, 40262193	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	30664745	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	27696742, 30664745, 36376028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	21228734	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (21)
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21767414, 34679093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Classical Lissencephaly	Lissencephaly	BEFREE	28734834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Foot Deformity	Congenital deformity of foot	BEFREE	24459211, 25231166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	GWASCAT_DG	30664745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	Pubtator	25231166, 27291887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30250299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32513296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30250299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	25231166, 27291887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31249807, 31605449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse	Mitral valve prolapse	Pubtator	27291887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11500918, 30250299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	30664745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	GWASCAT_DG	30664745		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	21228734		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	21228734		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	21228734		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spasms Infantile	Infantile spasms	Pubtator	35830182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Split foot	Split Hand Foot Deformity	BEFREE	24459211, 25231166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31249807, 31605449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31605449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GJE1	3	["Non-neoplastic peripheral nervous system disease","Peripheral nervous system disease","Peripheral neuropathy"]	0	[]	3	["Disgenet (Non-neoplastic peripheral nervous system disease)","CTD (Peripheral nervous system disease)","Disgenet (Peripheral neuropathy)"]
SERPINB2	3	["Non-neoplastic peripheral nervous system disease","Peripheral nervous system disease","Peripheral neuropathy"]	0	[]	3	["Disgenet (Non-neoplastic peripheral nervous system disease)","CTD (Peripheral nervous system disease)","Disgenet (Peripheral neuropathy)"]
PSMB1	3	["Non-neoplastic peripheral nervous system disease","Peripheral nervous system disease","Peripheral neuropathy"]	1	["Separation of Sister Chromatids"]	3	["Disgenet (Non-neoplastic peripheral nervous system disease)","CTD (Peripheral nervous system disease)","Disgenet (Peripheral neuropathy)"]
SOX8	3	["Non-neoplastic peripheral nervous system disease","Peripheral nervous system disease","Peripheral neuropathy"]	0	[]	3	["Disgenet (Non-neoplastic peripheral nervous system disease)","CTD (Peripheral nervous system disease)","Disgenet (Peripheral neuropathy)"]
XK	3	["Non-neoplastic peripheral nervous system disease","Peripheral nervous system disease","Peripheral neuropathy"]	0	[]	3	["Disgenet (Non-neoplastic peripheral nervous system disease)","CTD (Peripheral nervous system disease)","Disgenet (Peripheral neuropathy)"]

DYNC1I1 (dynein cytoplasmic 1 intermediate chain 1)

Bookmark This Gene