DNM3 (dynamin 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 26052
• Gene name: Dynamin 3
• Gene symbol: DNM3
• Synonyms (NCBI Gene): Dyna III
• Chromosome: 1
• Chromosome location: 1q24.3
• Summary: This gene encodes a member of a family of guanosine triphosphate (GTP)-binding proteins that associate with microtubules and are involved in vesicular transport. The encoded protein functions in the development of megakaryocytes. Alternative splicing resu

miRNA Show/Hide all (90)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022316	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT032198	hsa-let-7b-5p	Proteomics	18668040
MIRT942403	hsa-miR-1237	CLIP-seq
MIRT942404	hsa-miR-1248	CLIP-seq
MIRT942405	hsa-miR-1278	CLIP-seq
MIRT942406	hsa-miR-1297	CLIP-seq
MIRT942407	hsa-miR-26a	CLIP-seq
MIRT942408	hsa-miR-26b	CLIP-seq
MIRT942409	hsa-miR-3686	CLIP-seq
MIRT942410	hsa-miR-410	CLIP-seq
MIRT942411	hsa-miR-4432	CLIP-seq
MIRT942412	hsa-miR-4465	CLIP-seq
MIRT942413	hsa-miR-4672	CLIP-seq
MIRT942414	hsa-miR-4719	CLIP-seq
MIRT942415	hsa-miR-4742-3p	CLIP-seq
MIRT942416	hsa-miR-4778-3p	CLIP-seq
MIRT942417	hsa-miR-570	CLIP-seq
MIRT942418	hsa-miR-579	CLIP-seq
MIRT942405	hsa-miR-1278	CLIP-seq
MIRT942406	hsa-miR-1297	CLIP-seq
MIRT942407	hsa-miR-26a	CLIP-seq
MIRT942408	hsa-miR-26b	CLIP-seq
MIRT942419	hsa-miR-3137	CLIP-seq
MIRT942420	hsa-miR-3165	CLIP-seq
MIRT942421	hsa-miR-3182	CLIP-seq
MIRT942422	hsa-miR-3529	CLIP-seq
MIRT942423	hsa-miR-3653	CLIP-seq
MIRT942424	hsa-miR-3658	CLIP-seq
MIRT942425	hsa-miR-3682-5p	CLIP-seq
MIRT942409	hsa-miR-3686	CLIP-seq
MIRT942426	hsa-miR-379	CLIP-seq
MIRT942427	hsa-miR-3925-3p	CLIP-seq
MIRT942428	hsa-miR-4257	CLIP-seq
MIRT942429	hsa-miR-4307	CLIP-seq
MIRT942430	hsa-miR-4451	CLIP-seq
MIRT942431	hsa-miR-4456	CLIP-seq
MIRT942412	hsa-miR-4465	CLIP-seq
MIRT942432	hsa-miR-4477a	CLIP-seq
MIRT942433	hsa-miR-4517	CLIP-seq
MIRT942434	hsa-miR-4650-3p	CLIP-seq
MIRT942435	hsa-miR-4699-3p	CLIP-seq
MIRT942436	hsa-miR-520a-5p	CLIP-seq
MIRT942437	hsa-miR-525-5p	CLIP-seq
MIRT942438	hsa-miR-576-3p	CLIP-seq
MIRT942439	hsa-miR-766	CLIP-seq
MIRT1979018	hsa-miR-128	CLIP-seq
MIRT1979019	hsa-miR-3074-3p	CLIP-seq
MIRT1979020	hsa-miR-515-5p	CLIP-seq
MIRT1979021	hsa-miR-548p	CLIP-seq
MIRT2214161	hsa-miR-4729	CLIP-seq
MIRT2214162	hsa-miR-499-3p	CLIP-seq
MIRT2214163	hsa-miR-499a-3p	CLIP-seq
MIRT2214164	hsa-miR-513a-5p	CLIP-seq
MIRT2214165	hsa-miR-1292	CLIP-seq
MIRT2214166	hsa-miR-132	CLIP-seq
MIRT2214167	hsa-miR-212	CLIP-seq
MIRT2214168	hsa-miR-300	CLIP-seq
MIRT2214169	hsa-miR-381	CLIP-seq
MIRT2214170	hsa-miR-4328	CLIP-seq
MIRT2214171	hsa-miR-4471	CLIP-seq
MIRT2214172	hsa-miR-4646-5p	CLIP-seq
MIRT2214173	hsa-miR-4666-3p	CLIP-seq
MIRT2214174	hsa-miR-4774-5p	CLIP-seq
MIRT2214175	hsa-miR-548g	CLIP-seq
MIRT2214176	hsa-miR-587	CLIP-seq
MIRT2387049	hsa-miR-3691-5p	CLIP-seq
MIRT2442113	hsa-miR-142-5p	CLIP-seq
MIRT2442114	hsa-miR-340	CLIP-seq
MIRT2518528	hsa-miR-105	CLIP-seq
MIRT2518529	hsa-miR-140-3p	CLIP-seq
MIRT2518530	hsa-miR-148a	CLIP-seq
MIRT2518531	hsa-miR-148b	CLIP-seq
MIRT2518532	hsa-miR-152	CLIP-seq
MIRT2518533	hsa-miR-299-3p	CLIP-seq
MIRT2518534	hsa-miR-3129-3p	CLIP-seq
MIRT2518535	hsa-miR-3136-5p	CLIP-seq
MIRT2518536	hsa-miR-3153	CLIP-seq
MIRT2518537	hsa-miR-4439	CLIP-seq
MIRT2518538	hsa-miR-4513	CLIP-seq
MIRT2518539	hsa-miR-4648	CLIP-seq
MIRT2518540	hsa-miR-4654	CLIP-seq
MIRT2518541	hsa-miR-4662a-5p	CLIP-seq
MIRT2518542	hsa-miR-4666-5p	CLIP-seq
MIRT2518543	hsa-miR-4668-5p	CLIP-seq
MIRT2518544	hsa-miR-4769-5p	CLIP-seq
MIRT2518545	hsa-miR-4789-3p	CLIP-seq
MIRT2518546	hsa-miR-4793-5p	CLIP-seq
MIRT2518547	hsa-miR-556-3p	CLIP-seq
MIRT2518548	hsa-miR-943	CLIP-seq
MIRT2679374	hsa-miR-3185	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TWIST1	Activation	18033314

Gene ontology (GO) Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	ISS
GO:0005515	Function	Protein binding	IPI	15252009
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0006897	Process	Endocytosis	IEA
GO:0006897	Process	Endocytosis	ISS
GO:0007416	Process	Synapse assembly	ISS
GO:0008017	Function	Microtubule binding	IBA
GO:0014069	Component	Postsynaptic density	ISS
GO:0016185	Process	Synaptic vesicle budding from presynaptic endocytic zone membrane	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0042802	Function	Identical protein binding	IPI	26302298
GO:0043197	Component	Dendritic spine	ISS
GO:0045202	Component	Synapse	IBA
GO:0046847	Process	Filopodium assembly	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0098793	Component	Presynapse	IEA

Other IDs

• MIM: 611445
• HGNC: 29125
• e!Ensembl: ENSG00000197959

Protein

• UniProt ID: Q9UQ16
• Protein name: Dynamin-3 (EC 3.6.5.5) (Dynamin, testicular) (T-dynamin)
• Protein function: Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes, in particular endocytosis (By similarity).
• PDB: 3L43 , 5A3F
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	526 → 630	PH domain	Domain
  PF00350	Dynamin_N	34 → 207	Dynamin family	Domain
  PF01031	Dynamin_M	216 → 502	Dynamin central region	Family
  PF02212	GED	654 → 745	Dynamin GTPase effector domain	Family

• Sequence:

  MGNREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRG
  SGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPI
  NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTD
  LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQK
  DIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKL
  QGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGA
  KINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKL
  KGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLID
  IQVSYINTNHEDFIGFANAQQRSSQVHKKTTVGNQGTNLPPSRQIVIRKGWLTISNIGIM
  KGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQR
  NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSVAENDENGQAENFSMDPQLERQVE
  TIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAE
  QAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRP
  TLSAPLARPTSGRGPAPAIPSPGPHSGAPPVPFRPGPLPPFPSSSDSFGAPPQVPSRPTR
  APPSVPSRRPPPSPTRPTIIRPLESSLLD

• Sequence length: 869

Pathways

KEGG Pathway	Reactome Pathway
Phospholipase D signaling pathway	Toll Like Receptor 4 (TLR4) Cascade
Endocytosis	MHC class II antigen presentation
Synaptic vesicle cycle	Recycling pathway of L1
Endocrine and other factor-regulated calcium reabsorption	Clathrin-mediated endocytosis
Bacterial invasion of epithelial cells

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (14)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTROCYTOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	29059683	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	29059683	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	36914876, 40262193	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY NEOPLASMS	—	CTD	28321044	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	GWAS catalog	29273593	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	30595370, 32231276	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	37033223	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	37386247	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	30557369, 31488892	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	30557369, 31488892	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	32541925, 37033223, 38374256, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	31249589, 40050615	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (38)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	27993161, 33499882	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26784388	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32573516	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21548129	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30349300, 31388312		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24440977	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29449895		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29449895		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27837435		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22297481		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	28321044		★☆☆☆☆ Found in Text Mining only
Language Development Disorders	Language development disorders	Pubtator	33141070	Associate	★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	21117066		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26784388, 28599479		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	28321044		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21383689, 30349300		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30349300, 31388312		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	37380766	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	36400759	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21383689, 28599479, 31388312, 31572010		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24673776	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29145611	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29145611		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	27023174		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	29145611	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29145611		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	GWASCAT_DG	30557369		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34027641, 36528667	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31572010		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29473656, 30133089, 30340792, 31041581		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	27692902		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	33622874	Associate	★☆☆☆☆ Found in Text Mining only
Plexiform leiomyoma	Plexiform leiomyoma	GWASCAT_DG	31249589		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	LHGDN	18033314		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	18033314		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	26930587	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26784388	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	GWASCAT_DG	31249589		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

DNM1 9 shared pathwaysPhospholipase D signaling pathway, Endocytosis, Synaptic vesicle cycle, Endocrine and other factor-regulated calcium reabsorption, Bacterial invasion of epithelial cells, Toll Like Receptor 4 (TLR4) Cascade, MHC class II antigen presentation, Clathrin-mediated endocytosis, Recycling pathway of L1 Related via 9 shared pathways including Phospholipase D signaling pathway, Endocytosis. DNM2 9 shared pathwaysPhospholipase D signaling pathway, Endocytosis, Synaptic vesicle cycle, Endocrine and other factor-regulated calcium reabsorption, Bacterial invasion of epithelial cells, Toll Like Receptor 4 (TLR4) Cascade, MHC class II antigen presentation, Clathrin-mediated endocytosis, Recycling pathway of L1 Related via 9 shared pathways including Phospholipase D signaling pathway, Endocytosis. ACSM2A 2 shared evidence sourcesGWAS catalog (Astrocytoma), GWAS catalog (Nonalcoholic fatty liver disease) Related via 2 shared evidence sources. GPATCH2L 2 shared evidence sourcesGWAS catalog (Astrocytoma), GWAS catalog (Endometriosis) Related via 2 shared evidence sources. RSPO3 3 shared evidence sourcesGWAS catalog (Astrocytoma), GWAS catalog (Endometriosis), GWAS catalog (Nonalcoholic fatty liver disease) Related via 3 shared evidence sources.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
DNM1	0	[]	9	["Phospholipase D signaling pathway","Endocytosis","Synaptic vesicle cycle","Endocrine and other factor-regulated calcium reabsorption","Bacterial invasion of epithelial cells","Toll Like Receptor 4 (TLR4) Cascade","MHC class II antigen presentation","Clathrin-mediated endocytosis","Recycling pathway of L1"]	0	[]
DNM2	0	[]	9	["Phospholipase D signaling pathway","Endocytosis","Synaptic vesicle cycle","Endocrine and other factor-regulated calcium reabsorption","Bacterial invasion of epithelial cells","Toll Like Receptor 4 (TLR4) Cascade","MHC class II antigen presentation","Clathrin-mediated endocytosis","Recycling pathway of L1"]	0	[]
ACSM2A	0	[]	0	[]	2	["GWAS catalog (Astrocytoma)","GWAS catalog (Nonalcoholic fatty liver disease)"]
GPATCH2L	0	[]	0	[]	2	["GWAS catalog (Astrocytoma)","GWAS catalog (Endometriosis)"]
RSPO3	0	[]	0	[]	3	["GWAS catalog (Astrocytoma)","GWAS catalog (Endometriosis)","GWAS catalog (Nonalcoholic fatty liver disease)"]

Diseases Linked via Similar Genes

Obstructive pulmonary disease Linked via 3 of 5 related genesDNM2, GPATCH2L, RSPO3 Attention deficit hyperactivity disorder Linked via 2 of 5 related genesDNM1, RSPO3 Central nervous system cancer Linked via 2 of 5 related genesACSM2A, RSPO3 Glioma Linked via 2 of 5 related genesACSM2A, RSPO3 Alzheimer disease Linked via 2 of 5 related genesGPATCH2L, RSPO3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Obstructive pulmonary disease	3	["DNM2","GPATCH2L","RSPO3"]
Attention deficit hyperactivity disorder	2	["DNM1","RSPO3"]
Central nervous system cancer	2	["ACSM2A","RSPO3"]
Glioma	2	["ACSM2A","RSPO3"]
Alzheimer disease	2	["GPATCH2L","RSPO3"]