DNER (delta/notch like EGF repeat containing)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 92737
Gene name Delta/notch like EGF repeat containing
Gene symbol DNER
Synonyms (NCBI Gene)
UNQ26bet
Chromosome 2
Chromosome location 2q36.3
miRNA miRNA information provided by mirtarbase database.
19 Show/Hide all (19)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT942226 hsa-miR-3692 CLIP-seq
MIRT942227 hsa-miR-548ad CLIP-seq
MIRT942228 hsa-miR-548c-3p CLIP-seq
MIRT1978961 hsa-miR-510 CLIP-seq
MIRT1978962 hsa-miR-512-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23 Show/Hide all (23)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001764 Process Neuron migration NAS 11950833
GO:0004888 Function Transmembrane signaling receptor activity TAS 11950833
GO:0005112 Function Notch binding IBA
GO:0005112 Function Notch binding IEA
GO:0005509 Function Calcium ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607299 24456 ENSG00000187957
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NFT8
Protein name Delta and Notch-like epidermal growth factor-related receptor
Protein function Activator of the NOTCH1 pathway. May mediate neuron-glia interaction during astrocytogenesis (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00008 EGF 585 → 615 EGF-like domain Domain
PF00008 EGF 396 → 426 EGF-like domain Domain
PF00008 EGF 434 → 464 EGF-like domain Domain
PF00008 EGF 509 → 539 EGF-like domain Domain
PF00008 EGF 472 → 501 EGF-like domain Domain
PF00008 EGF 353 → 388 EGF-like domain Domain
PF00008 EGF 98 → 131 EGF-like domain Domain
PF12661 hEGF 552 → 573 Human growth factor-like EGF Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, spinal cord and adrenal gland. {ECO:0000269|PubMed:11997712}.
Sequence 
MQPRRAQAPGAQLLPALALLLLLLGAGPRGSSLANPVPAAPLSAPGPCAAQPCRNGGVCT
SRPEPDPQHPAPAGEPGYSCTCPAGISGANCQLVADPCASNPCHHGNCSSSSSSSSDGYL
CICNEGYEGPNCEQALPSLPATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQP
KTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLW
KVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTL
VVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCEEYDACQRKPCQN
NASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPE
GYFGSACEEKVDPCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSPCAHG
TCRSVGTSYKCLCDPGYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHC
ELYKDPCANVSCLNGATCDSDGLNGTCICAPGFTGEECDIDINECDSNPCHHGGSCLDQP
NGYNCHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHSLYIIIGALCVAFILMLIILIVG
ICRISRIEYQGSSRPAYEEFYNCRSIDSEFSNAIASIRHARFGKKSRPAMYDVSPIAYED
YSPDDKPLVTLIKTKDL
Sequence length 737
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
9
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (9)
Phenotype Name Clinical Significance Source Reference Evidence Score
BREAST CARCINOMA — GWAS catalog 34407845
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARPAL TUNNEL SYNDROME — GWAS catalog 34594039
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY — GWAS catalog 34020725
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE — GWAS catalog 37069358
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEMENTIA — GWAS catalog 39046104
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (196)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Coronary Syndrome Coronary Syndrome BEFREE 31520897
★★★★★
★☆☆☆☆
Found in Text Mining only
Acute leukemia Leukemia BEFREE 30374167
★★★★★
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 22904298
★★★★★
★☆☆☆☆
Found in Text Mining only
Acute pancreatitis Pancreatitis BEFREE 28648518
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 30087114
★★★★★
★☆☆☆☆
Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma B-cell Lymphoma BEFREE 29954928
★★★★★
★☆☆☆☆
Found in Text Mining only
Adult Medulloblastoma Medulloblastoma BEFREE 24231268, 24796395, 29511348, 29880921, 30611741, 31160565
★★★★★
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 30527999
★★★★★
★☆☆☆☆
Found in Text Mining only
Anaplastic thyroid carcinoma Anaplastic thyroid cancer BEFREE 26911376, 31272080
★★★★★
★☆☆☆☆
Found in Text Mining only
Ankylosing spondylitis Ankylosing Spondylitis BEFREE 29067128
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
ADCY9 2 shared diseasesCerebral amyloid angiopathy, Estrogen-receptor negative breast cancer 2 shared evidence sourcesGWAS catalog (Cerebral amyloid angiopathy), GWAS catalog (Estrogen-receptor negative breast cancer) Related via 2 shared diseases including Cerebral amyloid angiopathy, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. ZBTB38 2 shared diseasesCarpal tunnel syndrome, Estrogen-receptor negative breast cancer 2 shared evidence sourcesGWAS catalog (Carpal tunnel syndrome), GWAS catalog (Estrogen-receptor negative breast cancer) Related via 2 shared diseases including Carpal tunnel syndrome, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. MRTFA 2 shared diseasesCarpal tunnel syndrome, Estrogen-receptor negative breast cancer 2 shared evidence sourcesGWAS catalog (Carpal tunnel syndrome), GWAS catalog (Estrogen-receptor negative breast cancer) Related via 2 shared diseases including Carpal tunnel syndrome, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. FTO 2 shared diseasesCarpal tunnel syndrome, Estrogen-receptor negative breast cancer 2 shared evidence sourcesGWAS catalog (Carpal tunnel syndrome), GWAS catalog (Estrogen-receptor negative breast cancer) Related via 2 shared diseases including Carpal tunnel syndrome, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. HLA-DQB1 2 shared diseasesCarpal tunnel syndrome, Estrogen-receptor negative breast cancer 2 shared evidence sourcesGWAS catalog (Carpal tunnel syndrome), GWAS catalog (Estrogen-receptor negative breast cancer) Related via 2 shared diseases including Carpal tunnel syndrome, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog.
Cancer Linked via 4 of 5 related genesZBTB38, MRTFA, FTO, HLA-DQB1 Colorectal cancer Linked via 4 of 5 related genesZBTB38, MRTFA, FTO, HLA-DQB1 Lung cancer Linked via 4 of 5 related genesZBTB38, MRTFA, FTO, HLA-DQB1 Ovarian cancer Linked via 4 of 5 related genesZBTB38, MRTFA, FTO, HLA-DQB1 Ovarian serous carcinoma Linked via 4 of 5 related genesZBTB38, MRTFA, FTO, HLA-DQB1