DMAC2L (distal membrane arm assembly component 2 like)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 27109
Gene name Distal membrane arm assembly component 2 like
Gene symbol DMAC2L
Synonyms (NCBI Gene)
ATP5SATPWFBHSU79253
Chromosome 14
Chromosome location 14q21.3
Summary This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two lin
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618579 18799 ENSG00000125375
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99766
Protein name ATP synthase subunit s, mitochondrial (ATP synthase-coupling factor B) (FB) (Distal membrane arm assembly complex 2-like protein) (Mitochondrial ATP synthase regulatory component factor B)
Protein function Involved in regulation of mitochondrial membrane ATP synthase. Necessary for H(+) conduction of ATP synthase. Facilitates energy-driven catalysis of ATP synthesis by blocking a proton leak through an alternative proton exit pathway. {ECO:0000250
Family and domains
Sequence 
MCCAVSEQRLTCADQMMPFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDV
GPDRAASEWLLRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHM
EGLEHVEKIRLCKCHYIEDDCLLRLSQLENLQKTILEMEIISCGNITDKGIIALRHLRNL
KYLLLSDLPGVREKENLVQAFKTALPSLELKLQLK
Sequence length 215
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Formation of ATP by chemiosmotic coupling
Cristae formation
Sort by:
ATP5MG 2 shared pathwaysFormation of ATP by chemiosmotic coupling, Cristae formation Related via 2 shared pathways including Formation of ATP by chemiosmotic coupling, Cristae formation. ATP5ME 2 shared pathwaysFormation of ATP by chemiosmotic coupling, Cristae formation Related via 2 shared pathways including Formation of ATP by chemiosmotic coupling, Cristae formation. ATP5MF 2 shared pathwaysFormation of ATP by chemiosmotic coupling, Cristae formation Related via 2 shared pathways including Formation of ATP by chemiosmotic coupling, Cristae formation. ATP5PD 2 shared pathwaysFormation of ATP by chemiosmotic coupling, Cristae formation Related via 2 shared pathways including Formation of ATP by chemiosmotic coupling, Cristae formation. ATP6 2 shared pathwaysFormation of ATP by chemiosmotic coupling, Cristae formation Related via 2 shared pathways including Formation of ATP by chemiosmotic coupling, Cristae formation.
Major depressive disorder Linked via 1 of 5 related genesATP5MG Heart disease Linked via 1 of 5 related genesATP5ME Oculocutaneous albinism Linked via 1 of 5 related genesATP5ME Retinitis pigmentosa Linked via 1 of 5 related genesATP5ME Bipolar disorder Linked via 1 of 5 related genesATP5PD