Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10901
Gene name	Dehydrogenase/reductase 4
Gene symbol	DHRS4
Synonyms (NCBI Gene)	CRNRDRPHCRPSCDSCAD-SRLSDR-SRLSDR25C1SDR25C2
Chromosome	14
Chromosome location	14q11.2

47 Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041172	hsa-miR-181d-5p	CLASH	23622248
MIRT733044	hsa-miR-29a-5p	Luciferase reporter assayWestern blotting	33014873
MIRT934953	hsa-miR-1587	CLIP-seq
MIRT934954	hsa-miR-28-5p	CLIP-seq
MIRT934955	hsa-miR-3139	CLIP-seq
MIRT934956	hsa-miR-3176	CLIP-seq
MIRT934957	hsa-miR-330-3p	CLIP-seq
MIRT934958	hsa-miR-3922-3p	CLIP-seq
MIRT934959	hsa-miR-4265	CLIP-seq
MIRT934960	hsa-miR-4296	CLIP-seq
MIRT934961	hsa-miR-4320	CLIP-seq
MIRT934962	hsa-miR-4322	CLIP-seq
MIRT934963	hsa-miR-4417	CLIP-seq
MIRT934964	hsa-miR-4492	CLIP-seq
MIRT934965	hsa-miR-4498	CLIP-seq
MIRT934966	hsa-miR-4633-3p	CLIP-seq
MIRT934967	hsa-miR-4656	CLIP-seq
MIRT934968	hsa-miR-4675	CLIP-seq
MIRT934969	hsa-miR-4733-3p	CLIP-seq
MIRT934970	hsa-miR-4741	CLIP-seq
MIRT934971	hsa-miR-4783-3p	CLIP-seq
MIRT934972	hsa-miR-626	CLIP-seq
MIRT934973	hsa-miR-665	CLIP-seq
MIRT934974	hsa-miR-708	CLIP-seq
MIRT934975	hsa-miR-762	CLIP-seq
MIRT1976831	hsa-miR-1207-5p	CLIP-seq
MIRT1976832	hsa-miR-1287	CLIP-seq
MIRT1976833	hsa-miR-27a	CLIP-seq
MIRT1976834	hsa-miR-27b	CLIP-seq
MIRT1976835	hsa-miR-3652	CLIP-seq
MIRT1976836	hsa-miR-3667-3p	CLIP-seq
MIRT1976837	hsa-miR-4268	CLIP-seq
MIRT1976838	hsa-miR-4430	CLIP-seq
MIRT1976839	hsa-miR-4436b-3p	CLIP-seq
MIRT1976840	hsa-miR-4436b-5p	CLIP-seq
MIRT1976841	hsa-miR-4448	CLIP-seq
MIRT1976842	hsa-miR-4747-5p	CLIP-seq
MIRT1976843	hsa-miR-4763-3p	CLIP-seq
MIRT1976844	hsa-miR-5096	CLIP-seq
MIRT1976845	hsa-miR-513a-5p	CLIP-seq
MIRT1976846	hsa-miR-767-3p	CLIP-seq
MIRT1976847	hsa-miR-891b	CLIP-seq
MIRT2212141	hsa-miR-150	CLIP-seq
MIRT2212142	hsa-miR-4713-5p	CLIP-seq
MIRT2212143	hsa-miR-4768-5p	CLIP-seq
MIRT2212144	hsa-miR-532-3p	CLIP-seq
MIRT2212145	hsa-miR-942	CLIP-seq

29 Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000253	Function	3-beta-hydroxysteroid 3-dehydrogenase (NADP+) activity	IDA	18571493, 19056333, 23128527
GO:0004090	Function	Carbonyl reductase (NADPH) activity	IBA
GO:0004090	Function	Carbonyl reductase (NADPH) activity	IDA	18571493, 19056333, 23128527
GO:0004090	Function	Carbonyl reductase (NADPH) activity	IEA
GO:0005634	Component	Nucleus	IDA	22227495
GO:0005634	Component	Nucleus	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	ISS
GO:0005777	Component	Peroxisome	IBA
GO:0005777	Component	Peroxisome	IDA	17230527
GO:0005777	Component	Peroxisome	IEA
GO:0005778	Component	Peroxisomal membrane	HDA	21525035
GO:0005778	Component	Peroxisomal membrane	IDA	10333503
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006066	Process	Alcohol metabolic process	IDA	18571493
GO:0008202	Process	Steroid metabolic process	IDA	18571493, 19056333
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016655	Function	Oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	19442656
GO:0018455	Function	Alcohol dehydrogenase [NAD(P)+] activity	IDA	18571493
GO:0033703	Function	3-beta-hydroxy-5-beta-steroid dehydrogenase (NADP+) activity	IEA
GO:0042180	Process	Ketone metabolic process	IDA	18571493, 19056333
GO:0042572	Process	Retinol metabolic process	IEA
GO:0042574	Process	Retinal metabolic process	IBA
GO:0042802	Function	Identical protein binding	IDA	18571493
GO:0042802	Function	Identical protein binding	IPI	18571493
GO:0052650	Function	All-trans-retinol dehydrogenase (NADP+) activity	TAS
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IDA	19442656

MIM	HGNC	e!Ensembl
611596	16985	ENSG00000157326

Q9BTZ2

Protein name

Dehydrogenase/reductase SDR family member 4 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase) (CR) (NADPH-dependent retinol dehydrogenase/reductase) (NRDR) (humNRDR) (Peroxisomal short-chain alcohol dehydrogenase) (PSCD) (SCAD-SRL) (Short chain dehydrog

Protein function

NADPH-dependent oxidoreductase which catalyzes the reduction of a variety of compounds bearing carbonyl groups including ketosteroids, alpha-dicarbonyl compounds, aldehydes, aromatic ketones and quinones (PubMed:18571493, PubMed:19056333). Reduc

PDB

3O4R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13561	adh_short_C2	38 → 275		Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Predominantly expressed in normal cervix (at protein level). {ECO:0000269|PubMed:17230527}.; TISSUE SPECIFICITY: [Isoform 4]: Expressed in some neoplastic cervical tissues, but not in normal cervix (at protein level). {ECO

Sequence

MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVV
VSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVN
PFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFS
PYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIR
RLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL

Sequence length

278

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Retinol metabolism	RA biosynthesis pathway
Metabolic pathways	Peroxisomal protein import
Peroxisome

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Sarcoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (7)
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35273591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30254456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35414313	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30984540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30254456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17230527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	39376175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DHRS4 (dehydrogenase/reductase 4)

Bookmark This Gene