DBF4 (DBF4-CDC7 kinase regulatory subunit)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10926
• Gene name: DBF4-CDC7 kinase regulatory subunit
• Gene symbol: DBF4
• Synonyms (NCBI Gene): ASK, CHIF, DBF4A, ZDBF1
• Chromosome: 7
• Chromosome location: 7q21.12

miRNA Show/Hide all (71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027752	hsa-miR-98-5p	Microarray	19088304
MIRT664697	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT664696	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT664695	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT664694	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT664693	hsa-miR-4284	HITS-CLIP	23824327
MIRT664692	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT664691	hsa-miR-4325	HITS-CLIP	23824327
MIRT664690	hsa-miR-8057	HITS-CLIP	23824327
MIRT171548	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT171551	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT171549	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT171550	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT171556	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT664697	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT664696	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT664695	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT664694	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT664693	hsa-miR-4284	HITS-CLIP	23824327
MIRT664692	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT664691	hsa-miR-4325	HITS-CLIP	23824327
MIRT664690	hsa-miR-8057	HITS-CLIP	23824327
MIRT923623	hsa-miR-1193	CLIP-seq
MIRT923624	hsa-miR-155	CLIP-seq
MIRT923625	hsa-miR-2392	CLIP-seq
MIRT923626	hsa-miR-3182	CLIP-seq
MIRT923627	hsa-miR-3187-3p	CLIP-seq
MIRT923628	hsa-miR-323-5p	CLIP-seq
MIRT923629	hsa-miR-330-3p	CLIP-seq
MIRT923630	hsa-miR-383	CLIP-seq
MIRT923631	hsa-miR-4256	CLIP-seq
MIRT923632	hsa-miR-4276	CLIP-seq
MIRT923633	hsa-miR-4420	CLIP-seq
MIRT923634	hsa-miR-4435	CLIP-seq
MIRT923635	hsa-miR-4456	CLIP-seq
MIRT923636	hsa-miR-4504	CLIP-seq
MIRT923637	hsa-miR-4639-5p	CLIP-seq
MIRT923638	hsa-miR-4701-5p	CLIP-seq
MIRT923639	hsa-miR-4763-5p	CLIP-seq
MIRT923640	hsa-miR-4772-5p	CLIP-seq
MIRT923641	hsa-miR-548s	CLIP-seq
MIRT923642	hsa-miR-568	CLIP-seq
MIRT923643	hsa-miR-588	CLIP-seq
MIRT923644	hsa-miR-596	CLIP-seq
MIRT923645	hsa-miR-876-3p	CLIP-seq
MIRT1973627	hsa-miR-3607-3p	CLIP-seq
MIRT1973628	hsa-miR-3686	CLIP-seq
MIRT1973629	hsa-miR-4457	CLIP-seq
MIRT1973630	hsa-miR-4775	CLIP-seq
MIRT1973631	hsa-miR-498	CLIP-seq
MIRT1973632	hsa-miR-513b	CLIP-seq
MIRT1973633	hsa-miR-590-3p	CLIP-seq
MIRT2209177	hsa-miR-1299	CLIP-seq
MIRT2209178	hsa-miR-3130-5p	CLIP-seq
MIRT2209179	hsa-miR-3149	CLIP-seq
MIRT2209180	hsa-miR-3664-5p	CLIP-seq
MIRT1973628	hsa-miR-3686	CLIP-seq
MIRT2209181	hsa-miR-411	CLIP-seq
MIRT2209182	hsa-miR-4438	CLIP-seq
MIRT2209183	hsa-miR-4482	CLIP-seq
MIRT2209184	hsa-miR-4632	CLIP-seq
MIRT2209185	hsa-miR-4639-3p	CLIP-seq
MIRT1973631	hsa-miR-498	CLIP-seq
MIRT2209186	hsa-miR-5095	CLIP-seq
MIRT2209187	hsa-miR-622	CLIP-seq
MIRT2209188	hsa-miR-624	CLIP-seq
MIRT2209189	hsa-miR-875-3p	CLIP-seq
MIRT2679015	hsa-miR-4251	CLIP-seq
MIRT2679016	hsa-miR-4540	CLIP-seq
MIRT2679017	hsa-miR-486-5p	CLIP-seq
MIRT2679018	hsa-miR-580	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Activation	18503552
HES1	Activation	12420215
SP1	Activation	12420215

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	10373557
GO:0003676	Function	Nucleic acid binding	IEA
GO:0005515	Function	Protein binding	IPI	16899510, 23064647, 28514442, 29997176, 31515488, 32296183, 32707033, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006260	Process	DNA replication	IEA
GO:0006260	Process	DNA replication	TAS	10373557
GO:0008047	Function	Enzyme activator activity	TAS	10373557
GO:0008270	Function	Zinc ion binding	IEA
GO:0010571	Process	Positive regulation of nuclear cell cycle DNA replication	IBA
GO:0016604	Component	Nuclear body	IDA
GO:0031431	Component	Dbf4-dependent protein kinase complex	IBA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:1901987	Process	Regulation of cell cycle phase transition	IBA

Other IDs

• MIM: 604281
• HGNC: 17364
• e!Ensembl: ENSG00000006634

Protein

• UniProt ID: Q9UBU7
• Protein name: Protein DBF4 homolog A (Activator of S phase kinase) (Chiffon homolog A) (DBF4-type zinc finger-containing protein 1)
• Protein function: Regulatory subunit for CDC7 which activates its kinase activity thereby playing a central role in DNA replication and cell proliferation. Required for progression of S phase. The complex CDC7-DBF4A selectively phosphorylates MCM2 subunit at 'Ser
• PDB: 4F99 , 4F9A , 4F9B , 4F9C , 6YA6 , 6YA7 , 6YA8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07535	zf-DBF	291 → 334	DBF zinc finger	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in testis and thymus. Expressed also in most cancer cells lines. {ECO:0000269|PubMed:10373557}.
• Sequence:

  MNSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTI
  SEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQTLGRISPVPSPESAYTAETTSPH
  PSHDGSSFKSPDTVCLSRGKLLVEKAIKDHDFIPSNSILSNALSWGVKILHIDDIRYYIE
  QKKKELYLLKKSSTSVRDGGKRVGSGAQKTRTGRLKKPFVKVEDMSQLYRPFYLQLTNMP
  FINYSIQKPCSPFDVDKPSSMQKQTQVKLRIQTDGDKYGGTSIQLQLKEKKKKGYCECCL
  QKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYEKDTPKKKRIKYSVGSLSP
  VSASVLKKTEQKEKVELQHISQKDCQEDDTTVKEQNFLYKETQETEKKLLFISEPIPHPS
  NELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVD
  HYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ
  EHLTVQAKAPFHTPPEEPNECDFKNMDSLPSGKIHRKVKIILGRNRKENLEPNAEFDKRT
  EFITQEENRICSSPVQSLLDLFQTSEEKSEFLGFTSYTEKSGICNVLDIWEEENSDNLLT
  AFFSSPSTSTFTGF

• Sequence length: 674

Pathways

KEGG Pathway	Reactome Pathway
Cell cycle	Activation of ATR in response to replication stress
	Activation of the pre-replicative complex

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CDC7 3 shared pathwaysCell cycle, Activation of ATR in response to replication stress, Activation of the pre-replicative complex Related via 3 shared pathways including Cell cycle, Activation of ATR in response to replication stress. CDC45 3 shared pathwaysCell cycle, Activation of ATR in response to replication stress, Activation of the pre-replicative complex Related via 3 shared pathways including Cell cycle, Activation of ATR in response to replication stress. MCM10 2 shared pathwaysActivation of ATR in response to replication stress, Activation of the pre-replicative complex Related via 2 shared pathways including Activation of ATR in response to replication stress, Activation of the pre-replicative complex. MCM2 3 shared pathwaysCell cycle, Activation of ATR in response to replication stress, Activation of the pre-replicative complex Related via 3 shared pathways including Cell cycle, Activation of ATR in response to replication stress. MCM3 3 shared pathwaysCell cycle, Activation of ATR in response to replication stress, Activation of the pre-replicative complex Related via 3 shared pathways including Cell cycle, Activation of ATR in response to replication stress.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CDC7	0	[]	3	["Cell cycle","Activation of ATR in response to replication stress","Activation of the pre-replicative complex"]	0	[]
CDC45	0	[]	3	["Cell cycle","Activation of ATR in response to replication stress","Activation of the pre-replicative complex"]	0	[]
MCM10	0	[]	2	["Activation of ATR in response to replication stress","Activation of the pre-replicative complex"]	0	[]
MCM2	0	[]	3	["Cell cycle","Activation of ATR in response to replication stress","Activation of the pre-replicative complex"]	0	[]
MCM3	0	[]	3	["Cell cycle","Activation of ATR in response to replication stress","Activation of the pre-replicative complex"]	0	[]

Diseases Linked via Similar Genes

Hepatocellular carcinoma Linked via 3 of 5 related genesCDC45, MCM10, MCM2 Ear, patella, short stature syndrome Linked via 2 of 5 related genesCDC45, MCM3 Major depressive disorder Linked via 1 of 5 related genesCDC7 Substance abuse Linked via 1 of 5 related genesCDC7 Androgen insensitivity syndrome Linked via 1 of 5 related genesCDC45

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Hepatocellular carcinoma	3	["CDC45","MCM10","MCM2"]
Ear, patella, short stature syndrome	2	["CDC45","MCM3"]
Major depressive disorder	1	["CDC7"]
Substance abuse	1	["CDC7"]
Androgen insensitivity syndrome	1	["CDC45"]