Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1579
Gene name	Cytochrome P450 family 4 subfamily A member 11
Gene symbol	CYP4A11
Synonyms (NCBI Gene)	CP4YCYP4A2CYP4AIICYPIVA11
Chromosome	1
Chromosome location	1p33
Summary	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local

106 Show/Hide all (106)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028966	hsa-miR-26b-5p	Microarray	19088304
MIRT484062	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT484063	hsa-miR-4781-3p	PAR-CLIP	23592263
MIRT484061	hsa-miR-506-5p	PAR-CLIP	23592263
MIRT484060	hsa-miR-211-3p	PAR-CLIP	23592263
MIRT484059	hsa-miR-4270	PAR-CLIP	23592263
MIRT484058	hsa-miR-4441	PAR-CLIP	23592263
MIRT484057	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT484056	hsa-miR-6134	PAR-CLIP	23592263
MIRT484055	hsa-miR-4683	PAR-CLIP	23592263
MIRT484054	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT484053	hsa-miR-6745	PAR-CLIP	23592263
MIRT484051	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT484052	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT484050	hsa-miR-1293	PAR-CLIP	23592263
MIRT484049	hsa-miR-4483	PAR-CLIP	23592263
MIRT484048	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT484047	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT484046	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT484045	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT484044	hsa-miR-3127-5p	PAR-CLIP	23592263
MIRT484043	hsa-miR-1270	PAR-CLIP	23592263
MIRT484042	hsa-miR-620	PAR-CLIP	23592263
MIRT459111	hsa-miR-3154	PAR-CLIP	23592263
MIRT459110	hsa-miR-4690-5p	PAR-CLIP	23592263
MIRT459109	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT459107	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT459108	hsa-miR-940	PAR-CLIP	23592263
MIRT459106	hsa-miR-9500	PAR-CLIP	23592263
MIRT459105	hsa-miR-4514	PAR-CLIP	23592263
MIRT459104	hsa-miR-4692	PAR-CLIP	23592263
MIRT459103	hsa-miR-3185	PAR-CLIP	23592263
MIRT459102	hsa-miR-7515	PAR-CLIP	23592263
MIRT459101	hsa-miR-3665	PAR-CLIP	23592263
MIRT459100	hsa-miR-4736	PAR-CLIP	23592263
MIRT459099	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT459098	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT459097	hsa-miR-541-3p	PAR-CLIP	23592263
MIRT459096	hsa-miR-654-5p	PAR-CLIP	23592263
MIRT028966	hsa-miR-26b-5p	Microarray	27756246
MIRT028966	hsa-miR-26b-5p	Microarray	27756246
MIRT484062	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT484063	hsa-miR-4781-3p	PAR-CLIP	23592263
MIRT484061	hsa-miR-506-5p	PAR-CLIP	23592263
MIRT484060	hsa-miR-211-3p	PAR-CLIP	23592263
MIRT484059	hsa-miR-4270	PAR-CLIP	23592263
MIRT484058	hsa-miR-4441	PAR-CLIP	23592263
MIRT484057	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT484056	hsa-miR-6134	PAR-CLIP	23592263
MIRT484055	hsa-miR-4683	PAR-CLIP	23592263
MIRT484054	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT484053	hsa-miR-6745	PAR-CLIP	23592263
MIRT484051	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT484052	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT484050	hsa-miR-1293	PAR-CLIP	23592263
MIRT484049	hsa-miR-4483	PAR-CLIP	23592263
MIRT484048	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT484047	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT484046	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT484045	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT484044	hsa-miR-3127-5p	PAR-CLIP	23592263
MIRT484043	hsa-miR-1270	PAR-CLIP	23592263
MIRT484042	hsa-miR-620	PAR-CLIP	23592263
MIRT459111	hsa-miR-3154	PAR-CLIP	23592263
MIRT459110	hsa-miR-4690-5p	PAR-CLIP	23592263
MIRT459109	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT459107	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT459108	hsa-miR-940	PAR-CLIP	23592263
MIRT459106	hsa-miR-9500	PAR-CLIP	23592263
MIRT459105	hsa-miR-4514	PAR-CLIP	23592263
MIRT459104	hsa-miR-4692	PAR-CLIP	23592263
MIRT459103	hsa-miR-3185	PAR-CLIP	23592263
MIRT459102	hsa-miR-7515	PAR-CLIP	23592263
MIRT459101	hsa-miR-3665	PAR-CLIP	23592263
MIRT459100	hsa-miR-4736	PAR-CLIP	23592263
MIRT459099	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT459098	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT459097	hsa-miR-541-3p	PAR-CLIP	23592263
MIRT459096	hsa-miR-654-5p	PAR-CLIP	23592263
MIRT921628	hsa-miR-3132	CLIP-seq
MIRT921629	hsa-miR-3529	CLIP-seq
MIRT921630	hsa-miR-379	CLIP-seq
MIRT921631	hsa-miR-3927	CLIP-seq
MIRT921632	hsa-miR-4453	CLIP-seq
MIRT921633	hsa-miR-4457	CLIP-seq
MIRT921634	hsa-miR-4538	CLIP-seq
MIRT921635	hsa-miR-4694-5p	CLIP-seq
MIRT921636	hsa-miR-4717-5p	CLIP-seq
MIRT921637	hsa-miR-4753-5p	CLIP-seq
MIRT921638	hsa-miR-552	CLIP-seq
MIRT921628	hsa-miR-3132	CLIP-seq
MIRT921629	hsa-miR-3529	CLIP-seq
MIRT921630	hsa-miR-379	CLIP-seq
MIRT921631	hsa-miR-3927	CLIP-seq
MIRT921636	hsa-miR-4717-5p	CLIP-seq
MIRT921637	hsa-miR-4753-5p	CLIP-seq
MIRT921628	hsa-miR-3132	CLIP-seq
MIRT921629	hsa-miR-3529	CLIP-seq
MIRT921630	hsa-miR-379	CLIP-seq
MIRT921631	hsa-miR-3927	CLIP-seq
MIRT921638	hsa-miR-552	CLIP-seq
MIRT921632	hsa-miR-4453	CLIP-seq
MIRT921634	hsa-miR-4538	CLIP-seq
MIRT921635	hsa-miR-4694-5p	CLIP-seq
MIRT921636	hsa-miR-4717-5p	CLIP-seq
MIRT921637	hsa-miR-4753-5p	CLIP-seq

45 Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001676	Process	Long-chain fatty acid metabolic process	IDA	18433732
GO:0001822	Process	Kidney development	IBA
GO:0003091	Process	Renal water homeostasis	IEP	10660572
GO:0003095	Process	Pressure natriuresis	IEP	10660572
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004497	Function	Monooxygenase activity	TAS
GO:0005506	Function	Iron ion binding	IEA
GO:0005737	Component	Cytoplasm	IDA	10660572
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	TAS	7679927
GO:0006691	Process	Leukotriene metabolic process	IDA	9799565
GO:0008391	Function	Arachidonate monooxygenase activity	IBA
GO:0008392	Function	Arachidonate epoxygenase activity	IDA	9618440
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	10660572
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0018685	Function	Alkane 1-monooxygenase activity	IBA
GO:0018685	Function	Alkane 1-monooxygenase activity	IDA	18433732
GO:0018685	Function	Alkane 1-monooxygenase activity	TAS	7679927
GO:0019369	Process	Arachidonate metabolic process	IBA
GO:0019369	Process	Arachidonate metabolic process	IDA	10660572
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019373	Process	Epoxygenase P450 pathway	IDA	9618440
GO:0020037	Function	Heme binding	IEA
GO:0031408	Process	Oxylipin biosynthetic process	IEA
GO:0032305	Process	Positive regulation of icosanoid secretion	IMP	18391101
GO:0036101	Process	Leukotriene B4 catabolic process	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	9618440, 9799565, 10660572
GO:0043651	Process	Linoleic acid metabolic process	IBA
GO:0046456	Process	Icosanoid biosynthetic process	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048252	Process	Lauric acid metabolic process	IBA
GO:0050051	Function	Leukotriene-B4 20-monooxygenase activity	IDA	9799565
GO:0052869	Function	Arachidonate omega-hydroxylase activity	IEA
GO:0055078	Process	Sodium ion homeostasis	IEP	10660572
GO:0097267	Process	Omega-hydroxylase P450 pathway	TAS
GO:0102033	Function	Long-chain fatty acid omega-hydroxylase activity	IDA	15145985
GO:0102033	Function	Long-chain fatty acid omega-hydroxylase activity	IEA

MIM	HGNC	e!Ensembl
601310	2642	ENSG00000187048

Q02928

Protein name

Cytochrome P450 4A11 (EC 1.14.14.1) (20-hydroxyeicosatetraenoic acid synthase) (20-HETE synthase) (CYP4AII) (CYPIVA11) (Cytochrome P-450HK-omega) (Cytochrome P450HL-omega) (Fatty acid omega-hydroxylase) (Lauric acid omega-hydroxylase) (Long-chain fatty ac

Protein function

A cytochrome P450 monooxygenase involved in the metabolism of fatty acids and their oxygenated derivatives (oxylipins) (PubMed:10553002, PubMed:10660572, PubMed:15611369, PubMed:1739747, PubMed:7679927, PubMed:8914854). Mechanistically, uses mol

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00067	p450	51 → 505	Cytochrome P450	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in liver (PubMed:7679927). Expressed in S2 and S3 segments of proximal tubules in cortex and outer medulla of kidney (PubMed:10660572, PubMed:7679927). {ECO:0000269|PubMed:10660572, ECO:0000269|PubMed:7679927}.

Sequence

MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLF
GHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSY
RFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQD
SPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQND
TIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKM
ENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGAS
ITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHH
NPKVWPNPEVFDPFRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFEL
LPDPTRIPIPIARLVLKSKNGIHLRLRRLPNPCEDKDQL

Sequence length

519

Interactions

View interactions

Reactome Pathway
PPARA activates gene expression
Fatty acids
Miscellaneous substrates
Eicosanoids
Synthesis of Leukotrienes (LT) and Eoxins (EX)
Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	35663546	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	28284560	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD	36368619	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (47)
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25024626, 28430663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	26686738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	18484194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	20130494, 25734770, 25947240, 26959478, 27087514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	20130494, 24984178, 25734770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	30132788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28557975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19615687, 22327816, 23085321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19615687, 22327816, 23085321, 29484037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	22327816, 29484037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19615687, 22327816, 23085321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27916259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	38448299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	18227405, 18300855, 24164311, 24278241, 28534704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	18227405, 24164311, 28534704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	25399406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18591218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	18385420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	38003044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	18227405, 18385420, 21873888, 24535879, 25064769, 38448299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	15611369, 16144986, 18227405, 18300855, 18936345		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	16144986, 16957555, 17597703, 18227405, 18300855, 18385420, 18391101, 18574070, 18936345, 19675180, 21326303, 21617944, 21873888, 22173545, 23584425 View all (10 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	18385420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive Nephropathy	Hypertensive nephropathy	Pubtator	27756246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	32728162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	20130494, 25734770, 25947240, 27087514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18385420, 26558470, 38448299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	18385420, 38448299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25024626, 30069903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	25024626		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	25024626	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	25024626	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	25024626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34970420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25971253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multicystic Dysplastic Kidney	Multicystic renal dysplasia	BEFREE	26932690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	16957555, 22804341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	22804341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21120482, 28557975, 30069903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	LHGDN	18385420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	Pubtator	18385420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	17671740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31417029	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	18385420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	20130494, 25734770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	15191401		★★★★★ ★☆☆☆☆ Found in Text Mining only

CYP4A11 (cytochrome P450 family 4 subfamily A member 11)

Bookmark This Gene