Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	23191
Gene name	Cytoplasmic FMR1 interacting protein 1
Gene symbol	CYFIP1
Synonyms (NCBI Gene)	P140SRA-1SHYCSRA-1SRA1
Chromosome	15
Chromosome location	15q11.2
Summary	This gene encodes a protein that regulates cytoskeletal dynamics and protein translation. The encoded protein is a component of the WAVE regulatory complex (WRC), which promotes actin polymerization.This protein also interacts with the Fragile X mental re

134 Show/Hide all (134)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020537	hsa-miR-155-5p	Proteomics	18668040
MIRT045329	hsa-miR-185-5p	CLASH	23622248
MIRT042272	hsa-miR-484	CLASH	23622248
MIRT041300	hsa-miR-193b-3p	CLASH	23622248
MIRT920158	hsa-miR-214	CLIP-seq
MIRT920159	hsa-miR-3619-5p	CLIP-seq
MIRT920160	hsa-miR-4291	CLIP-seq
MIRT920161	hsa-miR-761	CLIP-seq
MIRT920162	hsa-miR-922	CLIP-seq
MIRT920163	hsa-miR-1178	CLIP-seq
MIRT920164	hsa-miR-1243	CLIP-seq
MIRT920165	hsa-miR-1290	CLIP-seq
MIRT920166	hsa-miR-1292	CLIP-seq
MIRT920167	hsa-miR-2964a-5p	CLIP-seq
MIRT920168	hsa-miR-31	CLIP-seq
MIRT920169	hsa-miR-3128	CLIP-seq
MIRT920170	hsa-miR-3167	CLIP-seq
MIRT920171	hsa-miR-3613-3p	CLIP-seq
MIRT920172	hsa-miR-4471	CLIP-seq
MIRT920173	hsa-miR-4502	CLIP-seq
MIRT920174	hsa-miR-4760-5p	CLIP-seq
MIRT920175	hsa-miR-4766-5p	CLIP-seq
MIRT920176	hsa-miR-494	CLIP-seq
MIRT920177	hsa-miR-569	CLIP-seq
MIRT920178	hsa-miR-582-3p	CLIP-seq
MIRT920179	hsa-miR-582-5p	CLIP-seq
MIRT920180	hsa-miR-876-5p	CLIP-seq
MIRT1972711	hsa-miR-590-3p	CLIP-seq
MIRT2208310	hsa-miR-1	CLIP-seq
MIRT2208311	hsa-miR-103a	CLIP-seq
MIRT2208312	hsa-miR-107	CLIP-seq
MIRT920164	hsa-miR-1243	CLIP-seq
MIRT920165	hsa-miR-1290	CLIP-seq
MIRT2208313	hsa-miR-15a	CLIP-seq
MIRT2208314	hsa-miR-15b	CLIP-seq
MIRT2208315	hsa-miR-16	CLIP-seq
MIRT2208316	hsa-miR-185	CLIP-seq
MIRT2208317	hsa-miR-1909	CLIP-seq
MIRT2208318	hsa-miR-195	CLIP-seq
MIRT2208319	hsa-miR-206	CLIP-seq
MIRT2208320	hsa-miR-216a	CLIP-seq
MIRT2208321	hsa-miR-22	CLIP-seq
MIRT920167	hsa-miR-2964a-5p	CLIP-seq
MIRT2208322	hsa-miR-300	CLIP-seq
MIRT2208323	hsa-miR-3121-3p	CLIP-seq
MIRT920170	hsa-miR-3167	CLIP-seq
MIRT2208324	hsa-miR-3190	CLIP-seq
MIRT2208325	hsa-miR-3591-5p	CLIP-seq
MIRT2208326	hsa-miR-3673	CLIP-seq
MIRT2208327	hsa-miR-3681	CLIP-seq
MIRT2208328	hsa-miR-3688-3p	CLIP-seq
MIRT2208329	hsa-miR-381	CLIP-seq
MIRT2208330	hsa-miR-3910	CLIP-seq
MIRT2208331	hsa-miR-424	CLIP-seq
MIRT2208332	hsa-miR-425	CLIP-seq
MIRT2208333	hsa-miR-4306	CLIP-seq
MIRT2208334	hsa-miR-4310	CLIP-seq
MIRT2208335	hsa-miR-4422	CLIP-seq
MIRT2208336	hsa-miR-4424	CLIP-seq
MIRT2208337	hsa-miR-4460	CLIP-seq
MIRT920173	hsa-miR-4502	CLIP-seq
MIRT2208338	hsa-miR-4530	CLIP-seq
MIRT2208339	hsa-miR-4644	CLIP-seq
MIRT2208340	hsa-miR-4659a-5p	CLIP-seq
MIRT2208341	hsa-miR-4659b-5p	CLIP-seq
MIRT2208342	hsa-miR-4666-3p	CLIP-seq
MIRT2208343	hsa-miR-4716-5p	CLIP-seq
MIRT2208344	hsa-miR-4727-3p	CLIP-seq
MIRT920174	hsa-miR-4760-5p	CLIP-seq
MIRT2208345	hsa-miR-4762-3p	CLIP-seq
MIRT920175	hsa-miR-4766-5p	CLIP-seq
MIRT2208346	hsa-miR-4788	CLIP-seq
MIRT920176	hsa-miR-494	CLIP-seq
MIRT2208347	hsa-miR-497	CLIP-seq
MIRT2208348	hsa-miR-548an	CLIP-seq
MIRT2208349	hsa-miR-548c-3p	CLIP-seq
MIRT920177	hsa-miR-569	CLIP-seq
MIRT920178	hsa-miR-582-3p	CLIP-seq
MIRT920179	hsa-miR-582-5p	CLIP-seq
MIRT1972711	hsa-miR-590-3p	CLIP-seq
MIRT2208350	hsa-miR-613	CLIP-seq
MIRT2208351	hsa-miR-642b	CLIP-seq
MIRT2208352	hsa-miR-671-5p	CLIP-seq
MIRT920180	hsa-miR-876-5p	CLIP-seq
MIRT920164	hsa-miR-1243	CLIP-seq
MIRT920165	hsa-miR-1290	CLIP-seq
MIRT920170	hsa-miR-3167	CLIP-seq
MIRT2208324	hsa-miR-3190	CLIP-seq
MIRT2208325	hsa-miR-3591-5p	CLIP-seq
MIRT2208327	hsa-miR-3681	CLIP-seq
MIRT2208337	hsa-miR-4460	CLIP-seq
MIRT2208344	hsa-miR-4727-3p	CLIP-seq
MIRT2208351	hsa-miR-642b	CLIP-seq
MIRT2208352	hsa-miR-671-5p	CLIP-seq
MIRT920180	hsa-miR-876-5p	CLIP-seq
MIRT920163	hsa-miR-1178	CLIP-seq
MIRT920166	hsa-miR-1292	CLIP-seq
MIRT2512090	hsa-miR-2114	CLIP-seq
MIRT920158	hsa-miR-214	CLIP-seq
MIRT2208320	hsa-miR-216a	CLIP-seq
MIRT2208321	hsa-miR-22	CLIP-seq
MIRT2208323	hsa-miR-3121-3p	CLIP-seq
MIRT2512091	hsa-miR-335	CLIP-seq
MIRT920171	hsa-miR-3613-3p	CLIP-seq
MIRT920159	hsa-miR-3619-5p	CLIP-seq
MIRT2512092	hsa-miR-3674	CLIP-seq
MIRT2512093	hsa-miR-3914	CLIP-seq
MIRT920160	hsa-miR-4291	CLIP-seq
MIRT2208335	hsa-miR-4422	CLIP-seq
MIRT920172	hsa-miR-4471	CLIP-seq
MIRT920176	hsa-miR-494	CLIP-seq
MIRT2512094	hsa-miR-513c	CLIP-seq
MIRT2512095	hsa-miR-514b-5p	CLIP-seq
MIRT2208349	hsa-miR-548c-3p	CLIP-seq
MIRT2208351	hsa-miR-642b	CLIP-seq
MIRT920161	hsa-miR-761	CLIP-seq
MIRT920162	hsa-miR-922	CLIP-seq
MIRT920163	hsa-miR-1178	CLIP-seq
MIRT920166	hsa-miR-1292	CLIP-seq
MIRT920158	hsa-miR-214	CLIP-seq
MIRT2208321	hsa-miR-22	CLIP-seq
MIRT2512091	hsa-miR-335	CLIP-seq
MIRT920171	hsa-miR-3613-3p	CLIP-seq
MIRT920159	hsa-miR-3619-5p	CLIP-seq
MIRT2512092	hsa-miR-3674	CLIP-seq
MIRT2512093	hsa-miR-3914	CLIP-seq
MIRT920160	hsa-miR-4291	CLIP-seq
MIRT920172	hsa-miR-4471	CLIP-seq
MIRT920176	hsa-miR-494	CLIP-seq
MIRT2512094	hsa-miR-513c	CLIP-seq
MIRT2512095	hsa-miR-514b-5p	CLIP-seq
MIRT2208351	hsa-miR-642b	CLIP-seq
MIRT920161	hsa-miR-761	CLIP-seq
MIRT920162	hsa-miR-922	CLIP-seq

56 Show/Hide all (56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000340	Function	RNA 7-methylguanosine cap binding	IBA
GO:0000902	Process	Cell morphogenesis	IBA
GO:0001726	Component	Ruffle	IEA
GO:0001726	Component	Ruffle	ISS
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	11438699, 15294869, 15296760, 16260607, 18805096, 19363480, 21107423, 24439377, 32814053, 33961781, 35271311
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006417	Process	Regulation of translation	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0010592	Process	Positive regulation of lamellipodium assembly	IDA	21107423
GO:0016601	Process	Rac protein signal transduction	IMP	21107423
GO:0017148	Process	Negative regulation of translation	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS
GO:0030032	Process	Lamellipodium assembly	IBA
GO:0030032	Process	Lamellipodium assembly	IEA
GO:0030032	Process	Lamellipodium assembly	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0030371	Function	Translation repressor activity	IEA
GO:0030371	Function	Translation repressor activity	ISS
GO:0030833	Process	Regulation of actin filament polymerization	IEA
GO:0031175	Process	Neuron projection development	IEA
GO:0031209	Component	SCAR complex	IBA
GO:0031209	Component	SCAR complex	IDA	18560548
GO:0031209	Component	SCAR complex	IMP	21107423
GO:0031252	Component	Cell leading edge	IEA
GO:0031267	Function	Small GTPase binding	IEA
GO:0031267	Function	Small GTPase binding	IMP	21107423
GO:0031267	Function	Small GTPase binding	ISS
GO:0031529	Process	Ruffle organization	ISS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035580	Component	Specific granule lumen	TAS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048675	Process	Axon extension	IMP	16260607
GO:0050890	Process	Cognition	IMP	17519220
GO:0051015	Function	Actin filament binding	ISS
GO:0051388	Process	Positive regulation of neurotrophin TRK receptor signaling pathway	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145
GO:0097484	Process	Dendrite extension	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0099578	Process	Regulation of translation at postsynapse, modulating synaptic transmission	IEA
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1905274	Process	Regulation of modification of postsynaptic actin cytoskeleton	IEA
GO:2000601	Process	Positive regulation of Arp2/3 complex-mediated actin nucleation	IMP	21107423

MIM	HGNC	e!Ensembl
606322	13759	ENSG00000273749

Q7L576

Protein name

Cytoplasmic FMR1-interacting protein 1 (Specifically Rac1-associated protein 1) (Sra-1) (p140sra-1)

Protein function

Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit is an adapter between EIF4E and FMR1. Promotes the translation repression activity of FMR

PDB

3P8C , 4N78 , 7USC , 7USD , 7USE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05994	FragX_IP	389 → 1222	Cytoplasmic Fragile-X interacting family	Family
PF07159	DUF1394	59 → 303	Protein of unknown function (DUF1394)	Family

Sequence

MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYI
EQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVT
KLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLAD
IVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCTSSGSSPQYNICEQMIQIREDHMRFI
SELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPT
DKYSNKDCPDSAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTV
YAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPK
SGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESF
FYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASM
MEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGS
LLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSL
ELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRIT
LHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSS
IYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKIC
RLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVC
DLLHAAPFQNILPRVHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDL
LTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCI
PVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVP
LKKMVERIRKFQILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS

Sequence length

1253

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Regulation of actin cytoskeleton	Regulation of actin dynamics for phagocytic cup formation
Pathogenic Escherichia coli infection	VEGFA-VEGFR2 Pathway
Salmonella infection	RHO GTPases Activate WASPs and WAVEs
	Neutrophil degranulation
	FCGR3A-mediated phagocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (22)
Acute myeloid leukemia	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	39245941	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL SEPTAL DEFECTS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC BEHAVIOR	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYFIP1-related disorder	Uncertain significance; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	33510476	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STRABISMUS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign; Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (43)
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26779626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26779626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	19328872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	31707462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	22346768, 33562221, 37724826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	24442360, 24818597, 25311365, 29752658, 30664619, 31198525, 31371726, 31705895		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	16183798, 20029941, 23838881, 25258334, 28183735, 29752658, 30784587, 31371726, 31704178		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	16183798, 34031371, 37508583, 38483902	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	29706651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33145876, 39408874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	28410392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28410392	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29402816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	26779626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25186548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	BEFREE	28254235		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29752658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	34680874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	26824476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28183735, 29992499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	28410392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	29114037, 30982501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	25205790, 36205932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36782329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	Pubtator	30342661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31202490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	25311365, 28183735, 30784587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Development Disorders	Language development disorders	Pubtator	28254235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26779626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29706651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26676744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	30342661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29534591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28410392, 29534591		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	24050404, 30784587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	BEFREE	16982806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	LHGDN	16982806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	26779626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22317777, 24996170, 25311365, 26824476, 28183735, 30784587, 31371726, 31704178		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	24996170		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	26824476, 34031371, 38483902	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spasms Infantile	Infantile spasms	Pubtator	29667327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28410392		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
NCKAP1	[]	7	["Regulation of actin cytoskeleton","Pathogenic Escherichia coli infection","Salmonella infection","Regulation of actin dynamics for phagocytic cup formation","VEGFA-VEGFR2 Pathway","RHO GTPases Activate WASPs and WAVEs","FCGR3A-mediated phagocytosis"]	[]
CYFIP2	[]	7	["Regulation of actin cytoskeleton","Pathogenic Escherichia coli infection","Salmonella infection","Regulation of actin dynamics for phagocytic cup formation","VEGFA-VEGFR2 Pathway","RHO GTPases Activate WASPs and WAVEs","FCGR3A-mediated phagocytosis"]	[]
NCKAP1L	[]	7	["Regulation of actin cytoskeleton","Pathogenic Escherichia coli infection","Salmonella infection","Regulation of actin dynamics for phagocytic cup formation","VEGFA-VEGFR2 Pathway","RHO GTPases Activate WASPs and WAVEs","FCGR3A-mediated phagocytosis"]	[]
BRK1	[]	7	["Regulation of actin cytoskeleton","Pathogenic Escherichia coli infection","Salmonella infection","Regulation of actin dynamics for phagocytic cup formation","VEGFA-VEGFR2 Pathway","RHO GTPases Activate WASPs and WAVEs","FCGR3A-mediated phagocytosis"]	[]
ABI1	[]	6	["Pathogenic Escherichia coli infection","Salmonella infection","Regulation of actin dynamics for phagocytic cup formation","VEGFA-VEGFR2 Pathway","RHO GTPases Activate WASPs and WAVEs","FCGR3A-mediated phagocytosis"]	[]

CYFIP1 (cytoplasmic FMR1 interacting protein 1)

Bookmark This Gene