CREB3L4 (cAMP responsive element binding protein 3 like 4)

Gene

• Entrez ID: 148327
• Gene name: CAMP responsive element binding protein 3 like 4
• Gene symbol: CREB3L4
• Synonyms (NCBI Gene): AIBZIP, ATCE1, CREB3, CREB4, JAL, hJAL
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: This gene encodes a CREB (cAMP responsive element binding) protein with a transmembrane domain which localizes it to the ER membrane. The encoded protein is a transcriptional activator which contains a dimerization domain, and this protein may function in

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT908896	hsa-let-7a	CLIP-seq
MIRT908897	hsa-let-7b	CLIP-seq
MIRT908898	hsa-let-7c	CLIP-seq
MIRT908899	hsa-let-7d	CLIP-seq
MIRT908900	hsa-let-7e	CLIP-seq
MIRT908901	hsa-let-7f	CLIP-seq
MIRT908902	hsa-let-7g	CLIP-seq
MIRT908903	hsa-let-7i	CLIP-seq
MIRT908904	hsa-miR-1229	CLIP-seq
MIRT908905	hsa-miR-1304	CLIP-seq
MIRT908906	hsa-miR-1323	CLIP-seq
MIRT908907	hsa-miR-202	CLIP-seq
MIRT908908	hsa-miR-3679-3p	CLIP-seq
MIRT908909	hsa-miR-371b-5p	CLIP-seq
MIRT908910	hsa-miR-4458	CLIP-seq
MIRT908911	hsa-miR-4500	CLIP-seq
MIRT908912	hsa-miR-548ad	CLIP-seq
MIRT908913	hsa-miR-548o	CLIP-seq
MIRT908914	hsa-miR-888	CLIP-seq
MIRT908915	hsa-miR-98	CLIP-seq
MIRT2205510	hsa-miR-125a-5p	CLIP-seq
MIRT2205511	hsa-miR-125b	CLIP-seq
MIRT2205512	hsa-miR-3163	CLIP-seq
MIRT2205513	hsa-miR-3166	CLIP-seq
MIRT2205514	hsa-miR-3616-3p	CLIP-seq
MIRT2205515	hsa-miR-4269	CLIP-seq
MIRT2205516	hsa-miR-4319	CLIP-seq
MIRT2205517	hsa-miR-4436b-3p	CLIP-seq
MIRT2205518	hsa-miR-4509	CLIP-seq
MIRT2205519	hsa-miR-4514	CLIP-seq
MIRT2205520	hsa-miR-4520b-3p	CLIP-seq
MIRT2205521	hsa-miR-4529-3p	CLIP-seq
MIRT2205522	hsa-miR-4535	CLIP-seq
MIRT2205523	hsa-miR-4668-3p	CLIP-seq
MIRT2205524	hsa-miR-4692	CLIP-seq
MIRT2205525	hsa-miR-4721	CLIP-seq
MIRT2205526	hsa-miR-4742-5p	CLIP-seq
MIRT2205527	hsa-miR-4747-5p	CLIP-seq
MIRT2205528	hsa-miR-4776-5p	CLIP-seq
MIRT2205529	hsa-miR-544b	CLIP-seq
MIRT2205530	hsa-miR-562	CLIP-seq
MIRT2205531	hsa-miR-711	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	IDA
GO:0005783	Component	Endoplasmic reticulum	IDA	16236796
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA	16236796
GO:0005794	Component	Golgi apparatus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006986	Process	Response to unfolded protein	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0016020	Component	Membrane	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16236796
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 607138
• HGNC: 18854
• e!Ensembl: ENSG00000143578

Protein

• UniProt ID: Q8TEY5
• Protein name: Cyclic AMP-responsive element-binding protein 3-like protein 4 (cAMP-responsive element-binding protein 3-like protein 4) (Androgen-induced basic leucine zipper protein) (AIbZIP) (Attaching to CRE-like 1) (ATCE1) (Cyclic AMP-responsive element-binding pro
• Protein function: Transcriptional activator that may play a role in the unfolded protein response. Binds to the UPR element (UPRE) but not to CRE element. Preferentially binds DNA with to the consensus sequence 5'-T[GT]ACGT[GA][GT]-3' and has transcriptional acti
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00170	bZIP_1	215 → 291	bZIP transcription factor	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: According to PubMed:11830526, exclusively expressed in the prostate. Expressed in breast and prostate cancer cell lines. Expressed in prostatic luminal epithelial cells (at protein level). Expression is significantly more abundant in p
• Sequence:

  MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGL
  QESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSPMLYEVVYEAG
  ALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAGTVAPVPCTT
  LLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
  YIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLI
  LLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPP
  GAKDANGSTRTLLEKMGGKPRPSGRIRSVLHADEM

• Sequence length: 395

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	17933519, 22539488		★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	29846607		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25077563		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25077563		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	18189280	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22004728, 28662179, 29249802, 30483806		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20473547, 28662179, 30483806, 32705365	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23023215	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38151984	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	23023215	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30105876, 31428516		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	19192256	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32820009, 36284436	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	34589056	Associate	★☆☆☆☆ Found in Text Mining only
Erythroblastosis, Fetal	Erythroblastosis Fetalis	BEFREE	19192256		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28246167		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31612863		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31612863		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27163161	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	26747525	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	38151984	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30121191		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26031464		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28056099	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22004728, 28662179, 29249802, 30483806		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	26796749		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30105876, 31428516		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17933519, 24441043, 28338058		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	27415467		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24481121, 30940151, 31428516		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28246167, 31293620		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24441043, 25825983, 26796749, 31612863, 9006982		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28170448		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30940151		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30105876, 31428516		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	34446027	Associate	★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	9006982		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17933519, 24441043, 28338058		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	17933519		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11830526		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	17933519, 24441043		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	27415467		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27853318, 28338058	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal carcinoma	Renal Carcinoma	BEFREE	26796749		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28618421		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16823369		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28246167		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22009750, 24481121	Associate	★☆☆☆☆ Found in Text Mining only