Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	92359
Gene name	Crumbs cell polarity complex component 3
Gene symbol	CRB3
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19p13.3
Summary	This gene encodes a member of the Crumbs family of proteins. This gene is widely expressed in epithelial tissues where the encoded protein isoforms play various roles such as the control of cytokinesis and ciliogenesis or the formation of tight junctions.

33 Show/Hide all (33)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017389	hsa-miR-335-5p	Microarray	18185580
MIRT908218	hsa-miR-1200	CLIP-seq
MIRT908219	hsa-miR-1287	CLIP-seq
MIRT908220	hsa-miR-2355-5p	CLIP-seq
MIRT908221	hsa-miR-2467-3p	CLIP-seq
MIRT908222	hsa-miR-2861	CLIP-seq
MIRT908223	hsa-miR-3135b	CLIP-seq
MIRT908224	hsa-miR-3151	CLIP-seq
MIRT908225	hsa-miR-3679-3p	CLIP-seq
MIRT908226	hsa-miR-370	CLIP-seq
MIRT908227	hsa-miR-377	CLIP-seq
MIRT908228	hsa-miR-3974	CLIP-seq
MIRT908229	hsa-miR-4265	CLIP-seq
MIRT908230	hsa-miR-4296	CLIP-seq
MIRT908231	hsa-miR-4322	CLIP-seq
MIRT908232	hsa-miR-4324	CLIP-seq
MIRT908233	hsa-miR-4447	CLIP-seq
MIRT908234	hsa-miR-4472	CLIP-seq
MIRT908235	hsa-miR-4638-3p	CLIP-seq
MIRT908236	hsa-miR-491-5p	CLIP-seq
MIRT908237	hsa-miR-544b	CLIP-seq
MIRT1969223	hsa-miR-4688	CLIP-seq
MIRT1969224	hsa-miR-486-3p	CLIP-seq
MIRT2205234	hsa-miR-4724-3p	CLIP-seq
MIRT2508467	hsa-miR-1205	CLIP-seq
MIRT2508468	hsa-miR-125a-5p	CLIP-seq
MIRT2508469	hsa-miR-125b	CLIP-seq
MIRT2508470	hsa-miR-3160-3p	CLIP-seq
MIRT2508471	hsa-miR-3620	CLIP-seq
MIRT2508472	hsa-miR-4269	CLIP-seq
MIRT2508473	hsa-miR-4319	CLIP-seq
MIRT2508474	hsa-miR-4487	CLIP-seq
MIRT2508475	hsa-miR-558	CLIP-seq

20 Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17920587, 20861307, 25416956, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005923	Component	Bicellular tight junction	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	NAS	19625503
GO:0017124	Function	SH3 domain binding	IPI	17332497
GO:0019904	Function	Protein domain specific binding	IPI	17332497
GO:0030054	Component	Cell junction	IDA
GO:0032991	Component	Protein-containing complex	IEA
GO:0035003	Component	Subapical complex	IEA
GO:0043296	Component	Apical junction complex	NAS	19625503
GO:0045177	Component	Apical part of cell	IEA
GO:0045197	Process	Establishment or maintenance of epithelial cell apical/basal polarity	NAS	19625503
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070161	Component	Anchoring junction	IEA
GO:0072659	Process	Protein localization to plasma membrane	IDA	17332497
GO:1901890	Process	Positive regulation of cell junction assembly	IEA
GO:1901890	Process	Positive regulation of cell junction assembly	ISS

MIM	HGNC	e!Ensembl
609737	20237	ENSG00000130545

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q9BUF7
Protein name	Protein crumbs homolog 3
Protein function	Involved in the establishment of cell polarity in mammalian epithelial cells (PubMed:12771187, PubMed:14718572, PubMed:23439680). Regulates the morphogenesis of tight junctions (PubMed:12771187, PubMed:14718572). Involved in promoting phosphoryl
PDB	5I7Z
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Preferentially expressed in epithelial tissues (PubMed:14718572). Expressed at high levels in lung, kidney, and colon (PubMed:12527193, PubMed:14718572). Expressed at high levels in retina, colon and mammary glands (PubMed:12527193). M
Sequence	MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAI IVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI
Sequence length	120
Interactions	View interactions

KEGG Pathway	Reactome Pathway
Tight junction	Tight junction interactions
Human papillomavirus infection

CRB3 (crumbs cell polarity complex component 3)