COX7A2L (cytochrome c oxidase subunit 7A2 like)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9167
• Gene name: Cytochrome c oxidase subunit 7A2 like
• Gene symbol: COX7A2L
• Synonyms (NCBI Gene): COX7AR, COX7RP, EB1, SCAF1, SCAFI, SIG81
• Chromosome: 2
• Chromosome location: 2p21
• Summary: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochond

miRNA Show/Hide all (359)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029500	hsa-miR-26b-5p	Microarray	19088304
MIRT042835	hsa-miR-324-3p	CLASH	23622248
MIRT616513	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT616512	hsa-miR-29a-3p	HITS-CLIP	23824327
MIRT616511	hsa-miR-29b-3p	HITS-CLIP	23824327
MIRT616510	hsa-miR-29c-3p	HITS-CLIP	23824327
MIRT616509	hsa-miR-330-3p	HITS-CLIP	23824327
MIRT616508	hsa-miR-6501-3p	HITS-CLIP	23824327
MIRT616507	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT616506	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT616505	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT440904	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440904	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT616513	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT616512	hsa-miR-29a-3p	HITS-CLIP	23824327
MIRT616511	hsa-miR-29b-3p	HITS-CLIP	23824327
MIRT616510	hsa-miR-29c-3p	HITS-CLIP	23824327
MIRT616509	hsa-miR-330-3p	HITS-CLIP	23824327
MIRT616508	hsa-miR-6501-3p	HITS-CLIP	23824327
MIRT616507	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT616506	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT616505	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT905527	hsa-miR-106a	CLIP-seq
MIRT905528	hsa-miR-106b	CLIP-seq
MIRT905529	hsa-miR-1260	CLIP-seq
MIRT905530	hsa-miR-1260b	CLIP-seq
MIRT905531	hsa-miR-130a	CLIP-seq
MIRT905532	hsa-miR-130b	CLIP-seq
MIRT905533	hsa-miR-17	CLIP-seq
MIRT905534	hsa-miR-188-3p	CLIP-seq
MIRT905535	hsa-miR-20a	CLIP-seq
MIRT905536	hsa-miR-20b	CLIP-seq
MIRT905537	hsa-miR-301a	CLIP-seq
MIRT905538	hsa-miR-301b	CLIP-seq
MIRT905539	hsa-miR-3156-3p	CLIP-seq
MIRT905540	hsa-miR-3609	CLIP-seq
MIRT905541	hsa-miR-3666	CLIP-seq
MIRT905542	hsa-miR-4295	CLIP-seq
MIRT905543	hsa-miR-4509	CLIP-seq
MIRT905544	hsa-miR-454	CLIP-seq
MIRT905545	hsa-miR-4678	CLIP-seq
MIRT905546	hsa-miR-4744	CLIP-seq
MIRT905547	hsa-miR-4796-3p	CLIP-seq
MIRT905548	hsa-miR-495	CLIP-seq
MIRT905549	hsa-miR-519a	CLIP-seq
MIRT905550	hsa-miR-519b-3p	CLIP-seq
MIRT905551	hsa-miR-519c-3p	CLIP-seq
MIRT905552	hsa-miR-519d	CLIP-seq
MIRT905553	hsa-miR-548ah	CLIP-seq
MIRT905554	hsa-miR-630	CLIP-seq
MIRT905555	hsa-miR-662	CLIP-seq
MIRT905556	hsa-miR-93	CLIP-seq
MIRT905527	hsa-miR-106a	CLIP-seq
MIRT905528	hsa-miR-106b	CLIP-seq
MIRT905529	hsa-miR-1260	CLIP-seq
MIRT905530	hsa-miR-1260b	CLIP-seq
MIRT905531	hsa-miR-130a	CLIP-seq
MIRT905532	hsa-miR-130b	CLIP-seq
MIRT905533	hsa-miR-17	CLIP-seq
MIRT905534	hsa-miR-188-3p	CLIP-seq
MIRT1968514	hsa-miR-205	CLIP-seq
MIRT905535	hsa-miR-20a	CLIP-seq
MIRT905536	hsa-miR-20b	CLIP-seq
MIRT905537	hsa-miR-301a	CLIP-seq
MIRT905538	hsa-miR-301b	CLIP-seq
MIRT905539	hsa-miR-3156-3p	CLIP-seq
MIRT1968515	hsa-miR-3157-5p	CLIP-seq
MIRT1968516	hsa-miR-337-3p	CLIP-seq
MIRT905540	hsa-miR-3609	CLIP-seq
MIRT1968517	hsa-miR-3614-3p	CLIP-seq
MIRT905541	hsa-miR-3666	CLIP-seq
MIRT1968518	hsa-miR-3941	CLIP-seq
MIRT905542	hsa-miR-4295	CLIP-seq
MIRT1968519	hsa-miR-4433	CLIP-seq
MIRT1968520	hsa-miR-4459	CLIP-seq
MIRT905543	hsa-miR-4509	CLIP-seq
MIRT905544	hsa-miR-454	CLIP-seq
MIRT1968521	hsa-miR-4643	CLIP-seq
MIRT1968522	hsa-miR-466	CLIP-seq
MIRT1968523	hsa-miR-4662a-3p	CLIP-seq
MIRT1968524	hsa-miR-4672	CLIP-seq
MIRT905545	hsa-miR-4678	CLIP-seq
MIRT1968525	hsa-miR-4698	CLIP-seq
MIRT905546	hsa-miR-4744	CLIP-seq
MIRT1968526	hsa-miR-4768-3p	CLIP-seq
MIRT1968527	hsa-miR-4789-3p	CLIP-seq
MIRT905547	hsa-miR-4796-3p	CLIP-seq
MIRT905548	hsa-miR-495	CLIP-seq
MIRT1968528	hsa-miR-518a-5p	CLIP-seq
MIRT905549	hsa-miR-519a	CLIP-seq
MIRT905550	hsa-miR-519b-3p	CLIP-seq
MIRT905551	hsa-miR-519c-3p	CLIP-seq
MIRT905552	hsa-miR-519d	CLIP-seq
MIRT1968529	hsa-miR-527	CLIP-seq
MIRT905553	hsa-miR-548ah	CLIP-seq
MIRT1968530	hsa-miR-578	CLIP-seq
MIRT905554	hsa-miR-630	CLIP-seq
MIRT905555	hsa-miR-662	CLIP-seq
MIRT905556	hsa-miR-93	CLIP-seq
MIRT905527	hsa-miR-106a	CLIP-seq
MIRT905528	hsa-miR-106b	CLIP-seq
MIRT905529	hsa-miR-1260	CLIP-seq
MIRT905530	hsa-miR-1260b	CLIP-seq
MIRT905531	hsa-miR-130a	CLIP-seq
MIRT905532	hsa-miR-130b	CLIP-seq
MIRT905533	hsa-miR-17	CLIP-seq
MIRT2204394	hsa-miR-1827	CLIP-seq
MIRT905534	hsa-miR-188-3p	CLIP-seq
MIRT2204395	hsa-miR-1976	CLIP-seq
MIRT1968514	hsa-miR-205	CLIP-seq
MIRT905535	hsa-miR-20a	CLIP-seq
MIRT905536	hsa-miR-20b	CLIP-seq
MIRT905537	hsa-miR-301a	CLIP-seq
MIRT905538	hsa-miR-301b	CLIP-seq
MIRT2204396	hsa-miR-3130-3p	CLIP-seq
MIRT905539	hsa-miR-3156-3p	CLIP-seq
MIRT905540	hsa-miR-3609	CLIP-seq
MIRT2204397	hsa-miR-3613-3p	CLIP-seq
MIRT905541	hsa-miR-3666	CLIP-seq
MIRT2204398	hsa-miR-371b-5p	CLIP-seq
MIRT905542	hsa-miR-4295	CLIP-seq
MIRT1968519	hsa-miR-4433	CLIP-seq
MIRT1968520	hsa-miR-4459	CLIP-seq
MIRT905543	hsa-miR-4509	CLIP-seq
MIRT905544	hsa-miR-454	CLIP-seq
MIRT905545	hsa-miR-4678	CLIP-seq
MIRT2204399	hsa-miR-4685-5p	CLIP-seq
MIRT905546	hsa-miR-4744	CLIP-seq
MIRT1968526	hsa-miR-4768-3p	CLIP-seq
MIRT905547	hsa-miR-4796-3p	CLIP-seq
MIRT905548	hsa-miR-495	CLIP-seq
MIRT905549	hsa-miR-519a	CLIP-seq
MIRT905550	hsa-miR-519b-3p	CLIP-seq
MIRT905551	hsa-miR-519c-3p	CLIP-seq
MIRT905552	hsa-miR-519d	CLIP-seq
MIRT905553	hsa-miR-548ah	CLIP-seq
MIRT2204400	hsa-miR-586	CLIP-seq
MIRT905554	hsa-miR-630	CLIP-seq
MIRT905555	hsa-miR-662	CLIP-seq
MIRT905556	hsa-miR-93	CLIP-seq
MIRT905527	hsa-miR-106a	CLIP-seq
MIRT905528	hsa-miR-106b	CLIP-seq
MIRT905531	hsa-miR-130a	CLIP-seq
MIRT905532	hsa-miR-130b	CLIP-seq
MIRT905533	hsa-miR-17	CLIP-seq
MIRT905535	hsa-miR-20a	CLIP-seq
MIRT905536	hsa-miR-20b	CLIP-seq
MIRT905537	hsa-miR-301a	CLIP-seq
MIRT905538	hsa-miR-301b	CLIP-seq
MIRT905540	hsa-miR-3609	CLIP-seq
MIRT905541	hsa-miR-3666	CLIP-seq
MIRT905542	hsa-miR-4295	CLIP-seq
MIRT905543	hsa-miR-4509	CLIP-seq
MIRT905544	hsa-miR-454	CLIP-seq
MIRT905545	hsa-miR-4678	CLIP-seq
MIRT905546	hsa-miR-4744	CLIP-seq
MIRT905547	hsa-miR-4796-3p	CLIP-seq
MIRT905549	hsa-miR-519a	CLIP-seq
MIRT905550	hsa-miR-519b-3p	CLIP-seq
MIRT905551	hsa-miR-519c-3p	CLIP-seq
MIRT905552	hsa-miR-519d	CLIP-seq
MIRT905553	hsa-miR-548ah	CLIP-seq
MIRT905554	hsa-miR-630	CLIP-seq
MIRT905556	hsa-miR-93	CLIP-seq
MIRT2507901	hsa-miR-103b	CLIP-seq
MIRT905527	hsa-miR-106a	CLIP-seq
MIRT905528	hsa-miR-106b	CLIP-seq
MIRT2507902	hsa-miR-125a-5p	CLIP-seq
MIRT2507903	hsa-miR-125b	CLIP-seq
MIRT905529	hsa-miR-1260	CLIP-seq
MIRT905530	hsa-miR-1260b	CLIP-seq
MIRT905531	hsa-miR-130a	CLIP-seq
MIRT905532	hsa-miR-130b	CLIP-seq
MIRT2507904	hsa-miR-135a	CLIP-seq
MIRT2507905	hsa-miR-135b	CLIP-seq
MIRT2507906	hsa-miR-143	CLIP-seq
MIRT905533	hsa-miR-17	CLIP-seq
MIRT2204394	hsa-miR-1827	CLIP-seq
MIRT905534	hsa-miR-188-3p	CLIP-seq
MIRT2204395	hsa-miR-1976	CLIP-seq
MIRT2507907	hsa-miR-203	CLIP-seq
MIRT1968514	hsa-miR-205	CLIP-seq
MIRT905535	hsa-miR-20a	CLIP-seq
MIRT905536	hsa-miR-20b	CLIP-seq
MIRT2507908	hsa-miR-2114	CLIP-seq
MIRT2507909	hsa-miR-2116	CLIP-seq
MIRT2507910	hsa-miR-221	CLIP-seq
MIRT2507911	hsa-miR-222	CLIP-seq
MIRT2507912	hsa-miR-29a	CLIP-seq
MIRT2507913	hsa-miR-29b	CLIP-seq
MIRT2507914	hsa-miR-29c	CLIP-seq
MIRT905537	hsa-miR-301a	CLIP-seq
MIRT905538	hsa-miR-301b	CLIP-seq
MIRT2507915	hsa-miR-3065-3p	CLIP-seq
MIRT2507916	hsa-miR-3065-5p	CLIP-seq
MIRT2507917	hsa-miR-3119	CLIP-seq
MIRT2507918	hsa-miR-3121-3p	CLIP-seq
MIRT2507919	hsa-miR-3124-3p	CLIP-seq
MIRT2204396	hsa-miR-3130-3p	CLIP-seq
MIRT905539	hsa-miR-3156-3p	CLIP-seq
MIRT1968515	hsa-miR-3157-5p	CLIP-seq
MIRT2507920	hsa-miR-3182	CLIP-seq
MIRT2507921	hsa-miR-323-3p	CLIP-seq
MIRT1968516	hsa-miR-337-3p	CLIP-seq
MIRT905540	hsa-miR-3609	CLIP-seq
MIRT2204397	hsa-miR-3613-3p	CLIP-seq
MIRT1968517	hsa-miR-3614-3p	CLIP-seq
MIRT2507922	hsa-miR-3660	CLIP-seq
MIRT905541	hsa-miR-3666	CLIP-seq
MIRT2507923	hsa-miR-3670	CLIP-seq
MIRT2507924	hsa-miR-3691-3p	CLIP-seq
MIRT2507925	hsa-miR-371-5p	CLIP-seq
MIRT2204398	hsa-miR-371b-5p	CLIP-seq
MIRT1968518	hsa-miR-3941	CLIP-seq
MIRT2507926	hsa-miR-4282	CLIP-seq
MIRT905542	hsa-miR-4295	CLIP-seq
MIRT2507927	hsa-miR-4319	CLIP-seq
MIRT1968519	hsa-miR-4433	CLIP-seq
MIRT1968520	hsa-miR-4459	CLIP-seq
MIRT2507928	hsa-miR-4494	CLIP-seq
MIRT2507929	hsa-miR-4499	CLIP-seq
MIRT905543	hsa-miR-4509	CLIP-seq
MIRT2507930	hsa-miR-4513	CLIP-seq
MIRT2507931	hsa-miR-4526	CLIP-seq
MIRT905544	hsa-miR-454	CLIP-seq
MIRT2507932	hsa-miR-4633-5p	CLIP-seq
MIRT1968521	hsa-miR-4643	CLIP-seq
MIRT1968522	hsa-miR-466	CLIP-seq
MIRT1968523	hsa-miR-4662a-3p	CLIP-seq
MIRT1968524	hsa-miR-4672	CLIP-seq
MIRT2507933	hsa-miR-4677-5p	CLIP-seq
MIRT905545	hsa-miR-4678	CLIP-seq
MIRT2204399	hsa-miR-4685-5p	CLIP-seq
MIRT2507934	hsa-miR-4732-3p	CLIP-seq
MIRT905546	hsa-miR-4744	CLIP-seq
MIRT1968526	hsa-miR-4768-3p	CLIP-seq
MIRT2507935	hsa-miR-4770	CLIP-seq
MIRT2507936	hsa-miR-4775	CLIP-seq
MIRT1968527	hsa-miR-4789-3p	CLIP-seq
MIRT905547	hsa-miR-4796-3p	CLIP-seq
MIRT2507937	hsa-miR-491-3p	CLIP-seq
MIRT905548	hsa-miR-495	CLIP-seq
MIRT1968528	hsa-miR-518a-5p	CLIP-seq
MIRT905549	hsa-miR-519a	CLIP-seq
MIRT905550	hsa-miR-519b-3p	CLIP-seq
MIRT905551	hsa-miR-519c-3p	CLIP-seq
MIRT905552	hsa-miR-519d	CLIP-seq
MIRT1968529	hsa-miR-527	CLIP-seq
MIRT2507938	hsa-miR-544b	CLIP-seq
MIRT905553	hsa-miR-548ah	CLIP-seq
MIRT2507939	hsa-miR-556-5p	CLIP-seq
MIRT1968530	hsa-miR-578	CLIP-seq
MIRT2204400	hsa-miR-586	CLIP-seq
MIRT2507940	hsa-miR-587	CLIP-seq
MIRT2507941	hsa-miR-590-3p	CLIP-seq
MIRT2507942	hsa-miR-629	CLIP-seq
MIRT905554	hsa-miR-630	CLIP-seq
MIRT905555	hsa-miR-662	CLIP-seq
MIRT2507943	hsa-miR-670	CLIP-seq
MIRT2507944	hsa-miR-888	CLIP-seq
MIRT905556	hsa-miR-93	CLIP-seq
MIRT2507945	hsa-miR-940	CLIP-seq
MIRT2507901	hsa-miR-103b	CLIP-seq
MIRT905527	hsa-miR-106a	CLIP-seq
MIRT905528	hsa-miR-106b	CLIP-seq
MIRT2507902	hsa-miR-125a-5p	CLIP-seq
MIRT2507903	hsa-miR-125b	CLIP-seq
MIRT905529	hsa-miR-1260	CLIP-seq
MIRT905530	hsa-miR-1260b	CLIP-seq
MIRT905531	hsa-miR-130a	CLIP-seq
MIRT905532	hsa-miR-130b	CLIP-seq
MIRT2507904	hsa-miR-135a	CLIP-seq
MIRT2507905	hsa-miR-135b	CLIP-seq
MIRT2507906	hsa-miR-143	CLIP-seq
MIRT905533	hsa-miR-17	CLIP-seq
MIRT2204394	hsa-miR-1827	CLIP-seq
MIRT905534	hsa-miR-188-3p	CLIP-seq
MIRT2204395	hsa-miR-1976	CLIP-seq
MIRT2507907	hsa-miR-203	CLIP-seq
MIRT1968514	hsa-miR-205	CLIP-seq
MIRT905535	hsa-miR-20a	CLIP-seq
MIRT905536	hsa-miR-20b	CLIP-seq
MIRT2507908	hsa-miR-2114	CLIP-seq
MIRT2507909	hsa-miR-2116	CLIP-seq
MIRT2507910	hsa-miR-221	CLIP-seq
MIRT2507911	hsa-miR-222	CLIP-seq
MIRT2507912	hsa-miR-29a	CLIP-seq
MIRT2507913	hsa-miR-29b	CLIP-seq
MIRT2507914	hsa-miR-29c	CLIP-seq
MIRT905537	hsa-miR-301a	CLIP-seq
MIRT905538	hsa-miR-301b	CLIP-seq
MIRT2507915	hsa-miR-3065-3p	CLIP-seq
MIRT2507916	hsa-miR-3065-5p	CLIP-seq
MIRT2507917	hsa-miR-3119	CLIP-seq
MIRT2507918	hsa-miR-3121-3p	CLIP-seq
MIRT2507919	hsa-miR-3124-3p	CLIP-seq
MIRT2204396	hsa-miR-3130-3p	CLIP-seq
MIRT905539	hsa-miR-3156-3p	CLIP-seq
MIRT1968515	hsa-miR-3157-5p	CLIP-seq
MIRT2507920	hsa-miR-3182	CLIP-seq
MIRT2507921	hsa-miR-323-3p	CLIP-seq
MIRT1968516	hsa-miR-337-3p	CLIP-seq
MIRT905540	hsa-miR-3609	CLIP-seq
MIRT2204397	hsa-miR-3613-3p	CLIP-seq
MIRT1968517	hsa-miR-3614-3p	CLIP-seq
MIRT2507922	hsa-miR-3660	CLIP-seq
MIRT905541	hsa-miR-3666	CLIP-seq
MIRT2507923	hsa-miR-3670	CLIP-seq
MIRT2507924	hsa-miR-3691-3p	CLIP-seq
MIRT2507925	hsa-miR-371-5p	CLIP-seq
MIRT2204398	hsa-miR-371b-5p	CLIP-seq
MIRT1968518	hsa-miR-3941	CLIP-seq
MIRT2507926	hsa-miR-4282	CLIP-seq
MIRT905542	hsa-miR-4295	CLIP-seq
MIRT2507927	hsa-miR-4319	CLIP-seq
MIRT1968519	hsa-miR-4433	CLIP-seq
MIRT1968520	hsa-miR-4459	CLIP-seq
MIRT2507928	hsa-miR-4494	CLIP-seq
MIRT2507929	hsa-miR-4499	CLIP-seq
MIRT905543	hsa-miR-4509	CLIP-seq
MIRT2507930	hsa-miR-4513	CLIP-seq
MIRT2507931	hsa-miR-4526	CLIP-seq
MIRT905544	hsa-miR-454	CLIP-seq
MIRT1968521	hsa-miR-4643	CLIP-seq
MIRT1968522	hsa-miR-466	CLIP-seq
MIRT1968523	hsa-miR-4662a-3p	CLIP-seq
MIRT1968524	hsa-miR-4672	CLIP-seq
MIRT2507933	hsa-miR-4677-5p	CLIP-seq
MIRT905545	hsa-miR-4678	CLIP-seq
MIRT2204399	hsa-miR-4685-5p	CLIP-seq
MIRT2507934	hsa-miR-4732-3p	CLIP-seq
MIRT905546	hsa-miR-4744	CLIP-seq
MIRT1968526	hsa-miR-4768-3p	CLIP-seq
MIRT2507935	hsa-miR-4770	CLIP-seq
MIRT2507936	hsa-miR-4775	CLIP-seq
MIRT1968527	hsa-miR-4789-3p	CLIP-seq
MIRT905547	hsa-miR-4796-3p	CLIP-seq
MIRT2507937	hsa-miR-491-3p	CLIP-seq
MIRT905548	hsa-miR-495	CLIP-seq
MIRT1968528	hsa-miR-518a-5p	CLIP-seq
MIRT905549	hsa-miR-519a	CLIP-seq
MIRT905550	hsa-miR-519b-3p	CLIP-seq
MIRT905551	hsa-miR-519c-3p	CLIP-seq
MIRT905552	hsa-miR-519d	CLIP-seq
MIRT1968529	hsa-miR-527	CLIP-seq
MIRT2507938	hsa-miR-544b	CLIP-seq
MIRT905553	hsa-miR-548ah	CLIP-seq
MIRT2507939	hsa-miR-556-5p	CLIP-seq
MIRT1968530	hsa-miR-578	CLIP-seq
MIRT2204400	hsa-miR-586	CLIP-seq
MIRT2507940	hsa-miR-587	CLIP-seq
MIRT2507941	hsa-miR-590-3p	CLIP-seq
MIRT2507942	hsa-miR-629	CLIP-seq
MIRT905554	hsa-miR-630	CLIP-seq
MIRT905555	hsa-miR-662	CLIP-seq
MIRT2507943	hsa-miR-670	CLIP-seq
MIRT2507944	hsa-miR-888	CLIP-seq
MIRT905556	hsa-miR-93	CLIP-seq
MIRT2507945	hsa-miR-940	CLIP-seq

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004129	Function	Cytochrome-c oxidase activity	TAS	9418891
GO:0005730	Component	Nucleolus	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	27545886
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	27545886
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	IEA
GO:0016020	Component	Membrane	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	27545886, 30428348
GO:0030674	Function	Protein-macromolecule adaptor activity	IMP	36198313
GO:0031966	Component	Mitochondrial membrane	IBA
GO:0045277	Component	Respiratory chain complex IV	IEA
GO:0097250	Process	Mitochondrial respirasome assembly	IDA	27545886, 30428348, 31023583
GO:0097250	Process	Mitochondrial respirasome assembly	IMP	36198313
GO:1902600	Process	Proton transmembrane transport	IEA

Other IDs

• MIM: 605771
• HGNC: 2289
• e!Ensembl: ENSG00000115944

Protein

• UniProt ID: O14548
• Protein name: Cytochrome c oxidase subunit 7A2-like, mitochondrial (Cytochrome c oxidase subunit 7A-related protein) (COX7a-related protein) (Cytochrome c oxidase subunit VIIa-related protein) (EB1) (Supercomplex assembly factor 1)
• Protein function: Assembly factor that mediates the formation of some mitochondrial respiratory supercomplexes (respirasomes), thereby promoting oxidative phosphorylation and energy metabolism (PubMed:27545886, PubMed:30428348, PubMed:33727070, PubMed:36198313).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02238	COX7a	58 → 110	Cytochrome c oxidase subunit VII	Family

• Sequence:

  MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKV
  PELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK

• Sequence length: 114

Pathways

KEGG Pathway	Reactome Pathway
Oxidative phosphorylation	TP53 Regulates Metabolic Genes
Metabolic pathways	Respiratory electron transport
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
COLORECTAL CANCER	—	GWAS catalog	31826910	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	38102678	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	26908601	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	26908601	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (21)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	9823979		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27550821, 31511525		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31511525	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	26908601		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28903393, 9823979		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	GWASCAT_DG	26908601		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31511525		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31511525	Stimulate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	GWASCAT_DG	26908601		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	20578947		★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	11156535	Associate	★☆☆☆☆ Found in Text Mining only
Leigh syndrome French Canadian type	Leigh syndrome	Pubtator	11156535	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27550821, 31511525		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31511525		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27550821		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30094535, 9823979		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	16769578		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	16769578		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	31511525	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27208742		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28903393		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

COX4I1 10 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy, TP53 Regulates Metabolic Genes, Respiratory electron transport Related via 10 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction. COX5B 10 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy, TP53 Regulates Metabolic Genes, Respiratory electron transport Related via 10 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction. COX6A1 10 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy, TP53 Regulates Metabolic Genes, Respiratory electron transport Related via 10 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction. COX6B1 10 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy, TP53 Regulates Metabolic Genes, Respiratory electron transport Related via 10 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction. COX6C 10 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy, TP53 Regulates Metabolic Genes, Respiratory electron transport Related via 10 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
COX4I1	0	[]	10	["Oxidative phosphorylation","Cardiac muscle contraction","Thermogenesis","Non-alcoholic fatty liver disease","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","TP53 Regulates Metabolic Genes","Respiratory electron transport"]	0	[]
COX5B	0	[]	10	["Oxidative phosphorylation","Cardiac muscle contraction","Thermogenesis","Non-alcoholic fatty liver disease","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","TP53 Regulates Metabolic Genes","Respiratory electron transport"]	0	[]
COX6A1	0	[]	10	["Oxidative phosphorylation","Cardiac muscle contraction","Thermogenesis","Non-alcoholic fatty liver disease","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","TP53 Regulates Metabolic Genes","Respiratory electron transport"]	0	[]
COX6B1	0	[]	10	["Oxidative phosphorylation","Cardiac muscle contraction","Thermogenesis","Non-alcoholic fatty liver disease","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","TP53 Regulates Metabolic Genes","Respiratory electron transport"]	0	[]
COX6C	0	[]	10	["Oxidative phosphorylation","Cardiac muscle contraction","Thermogenesis","Non-alcoholic fatty liver disease","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","TP53 Regulates Metabolic Genes","Respiratory electron transport"]	0	[]

Diseases Linked via Similar Genes

Mitochondrial disease Linked via 3 of 5 related genesCOX4I1, COX6A1, COX6B1 Cytochrome c oxidase deficiency Linked via 2 of 5 related genesCOX4I1, COX6B1 Mitochondrial complex deficiency Linked via 2 of 5 related genesCOX4I1, COX6B1 Leigh syndrome Linked via 1 of 5 related genesCOX4I1 Myocardial ischemia Linked via 1 of 5 related genesCOX5B

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Mitochondrial disease	3	["COX4I1","COX6A1","COX6B1"]
Cytochrome c oxidase deficiency	2	["COX4I1","COX6B1"]
Mitochondrial complex deficiency	2	["COX4I1","COX6B1"]
Leigh syndrome	1	["COX4I1"]
Myocardial ischemia	1	["COX5B"]