Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10980
Gene name	COP9 signalosome subunit 6
Gene symbol	COPS6
Synonyms (NCBI Gene)	CSN6MOV34-34KD
Chromosome	7
Chromosome location	7q22.1
Summary	The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to tha

181 Show/Hide all (181)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024115	hsa-let-7i-5p	Western blot	21530537
MIRT032093	hsa-let-7f-5p	Western blot	21530537
MIRT032097	hsa-let-7e-3p	Western blot	21530537
MIRT032192	hsa-let-7c-5p	Western blot	21530537
MIRT049676	hsa-miR-92a-3p	CLASH	23622248
MIRT043782	hsa-miR-328-3p	CLASH	23622248
MIRT904059	hsa-miR-105	CLIP-seq
MIRT904060	hsa-miR-1226	CLIP-seq
MIRT904061	hsa-miR-1266	CLIP-seq
MIRT904062	hsa-miR-1909	CLIP-seq
MIRT904063	hsa-miR-199a-5p	CLIP-seq
MIRT904064	hsa-miR-199b-5p	CLIP-seq
MIRT904065	hsa-miR-214	CLIP-seq
MIRT904066	hsa-miR-3154	CLIP-seq
MIRT904067	hsa-miR-3158-3p	CLIP-seq
MIRT904068	hsa-miR-342-5p	CLIP-seq
MIRT904069	hsa-miR-3619-5p	CLIP-seq
MIRT904070	hsa-miR-3671	CLIP-seq
MIRT904071	hsa-miR-371-3p	CLIP-seq
MIRT904072	hsa-miR-371b-3p	CLIP-seq
MIRT904073	hsa-miR-3907	CLIP-seq
MIRT904074	hsa-miR-3922-5p	CLIP-seq
MIRT904075	hsa-miR-4302	CLIP-seq
MIRT904076	hsa-miR-4303	CLIP-seq
MIRT904077	hsa-miR-4518	CLIP-seq
MIRT904078	hsa-miR-4530	CLIP-seq
MIRT904079	hsa-miR-4664-5p	CLIP-seq
MIRT904080	hsa-miR-4708-3p	CLIP-seq
MIRT904081	hsa-miR-4753-5p	CLIP-seq
MIRT904082	hsa-miR-515-3p	CLIP-seq
MIRT904083	hsa-miR-519e	CLIP-seq
MIRT904084	hsa-miR-522	CLIP-seq
MIRT904085	hsa-miR-607	CLIP-seq
MIRT904086	hsa-miR-615-5p	CLIP-seq
MIRT904087	hsa-miR-634	CLIP-seq
MIRT904088	hsa-miR-761	CLIP-seq
MIRT904059	hsa-miR-105	CLIP-seq
MIRT1968033	hsa-miR-129-3p	CLIP-seq
MIRT1968034	hsa-miR-1297	CLIP-seq
MIRT1968035	hsa-miR-134	CLIP-seq
MIRT1968036	hsa-miR-26a	CLIP-seq
MIRT1968037	hsa-miR-26b	CLIP-seq
MIRT1968038	hsa-miR-3118	CLIP-seq
MIRT1968039	hsa-miR-3136-5p	CLIP-seq
MIRT904066	hsa-miR-3154	CLIP-seq
MIRT904067	hsa-miR-3158-3p	CLIP-seq
MIRT1968040	hsa-miR-339-5p	CLIP-seq
MIRT904070	hsa-miR-3671	CLIP-seq
MIRT904076	hsa-miR-4303	CLIP-seq
MIRT1968041	hsa-miR-4439	CLIP-seq
MIRT1968042	hsa-miR-4465	CLIP-seq
MIRT1968043	hsa-miR-4477a	CLIP-seq
MIRT1968044	hsa-miR-4513	CLIP-seq
MIRT1968045	hsa-miR-4690-3p	CLIP-seq
MIRT1968046	hsa-miR-4711-5p	CLIP-seq
MIRT904084	hsa-miR-522	CLIP-seq
MIRT904085	hsa-miR-607	CLIP-seq
MIRT904086	hsa-miR-615-5p	CLIP-seq
MIRT904060	hsa-miR-1226	CLIP-seq
MIRT904062	hsa-miR-1909	CLIP-seq
MIRT904065	hsa-miR-214	CLIP-seq
MIRT904069	hsa-miR-3619-5p	CLIP-seq
MIRT904078	hsa-miR-4530	CLIP-seq
MIRT2203952	hsa-miR-4639-5p	CLIP-seq
MIRT904087	hsa-miR-634	CLIP-seq
MIRT904088	hsa-miR-761	CLIP-seq
MIRT904059	hsa-miR-105	CLIP-seq
MIRT904060	hsa-miR-1226	CLIP-seq
MIRT2507139	hsa-miR-1269	CLIP-seq
MIRT2507140	hsa-miR-1269b	CLIP-seq
MIRT1968033	hsa-miR-129-3p	CLIP-seq
MIRT1968034	hsa-miR-1297	CLIP-seq
MIRT2507141	hsa-miR-142-3p	CLIP-seq
MIRT904062	hsa-miR-1909	CLIP-seq
MIRT904063	hsa-miR-199a-5p	CLIP-seq
MIRT904064	hsa-miR-199b-5p	CLIP-seq
MIRT904065	hsa-miR-214	CLIP-seq
MIRT2507142	hsa-miR-2277-3p	CLIP-seq
MIRT1968036	hsa-miR-26a	CLIP-seq
MIRT1968037	hsa-miR-26b	CLIP-seq
MIRT2507143	hsa-miR-3122	CLIP-seq
MIRT2507144	hsa-miR-3127-3p	CLIP-seq
MIRT904066	hsa-miR-3154	CLIP-seq
MIRT904067	hsa-miR-3158-3p	CLIP-seq
MIRT2507145	hsa-miR-3190	CLIP-seq
MIRT1968040	hsa-miR-339-5p	CLIP-seq
MIRT904069	hsa-miR-3619-5p	CLIP-seq
MIRT904070	hsa-miR-3671	CLIP-seq
MIRT2507146	hsa-miR-3691-3p	CLIP-seq
MIRT904071	hsa-miR-371-3p	CLIP-seq
MIRT904072	hsa-miR-371b-3p	CLIP-seq
MIRT2507147	hsa-miR-3913-5p	CLIP-seq
MIRT904074	hsa-miR-3922-5p	CLIP-seq
MIRT2507148	hsa-miR-4280	CLIP-seq
MIRT2507149	hsa-miR-4290	CLIP-seq
MIRT904075	hsa-miR-4302	CLIP-seq
MIRT904076	hsa-miR-4303	CLIP-seq
MIRT2507150	hsa-miR-4420	CLIP-seq
MIRT2507151	hsa-miR-4423-5p	CLIP-seq
MIRT1968042	hsa-miR-4465	CLIP-seq
MIRT2507152	hsa-miR-4469	CLIP-seq
MIRT2507153	hsa-miR-450b-3p	CLIP-seq
MIRT2507154	hsa-miR-4514	CLIP-seq
MIRT2507155	hsa-miR-4529-3p	CLIP-seq
MIRT904078	hsa-miR-4530	CLIP-seq
MIRT2203952	hsa-miR-4639-5p	CLIP-seq
MIRT1968045	hsa-miR-4690-3p	CLIP-seq
MIRT2507156	hsa-miR-4690-5p	CLIP-seq
MIRT2507157	hsa-miR-4692	CLIP-seq
MIRT904080	hsa-miR-4708-3p	CLIP-seq
MIRT2507158	hsa-miR-4709-3p	CLIP-seq
MIRT1968046	hsa-miR-4711-5p	CLIP-seq
MIRT904081	hsa-miR-4753-5p	CLIP-seq
MIRT2507159	hsa-miR-4768-5p	CLIP-seq
MIRT2507160	hsa-miR-4786-5p	CLIP-seq
MIRT2507161	hsa-miR-513c	CLIP-seq
MIRT2507162	hsa-miR-514b-5p	CLIP-seq
MIRT904082	hsa-miR-515-3p	CLIP-seq
MIRT904083	hsa-miR-519e	CLIP-seq
MIRT904084	hsa-miR-522	CLIP-seq
MIRT904085	hsa-miR-607	CLIP-seq
MIRT904086	hsa-miR-615-5p	CLIP-seq
MIRT904087	hsa-miR-634	CLIP-seq
MIRT2507163	hsa-miR-671-5p	CLIP-seq
MIRT904088	hsa-miR-761	CLIP-seq
MIRT2507164	hsa-miR-769-3p	CLIP-seq
MIRT904059	hsa-miR-105	CLIP-seq
MIRT2507139	hsa-miR-1269	CLIP-seq
MIRT2507140	hsa-miR-1269b	CLIP-seq
MIRT1968033	hsa-miR-129-3p	CLIP-seq
MIRT1968034	hsa-miR-1297	CLIP-seq
MIRT2507141	hsa-miR-142-3p	CLIP-seq
MIRT904063	hsa-miR-199a-5p	CLIP-seq
MIRT904064	hsa-miR-199b-5p	CLIP-seq
MIRT2507142	hsa-miR-2277-3p	CLIP-seq
MIRT1968036	hsa-miR-26a	CLIP-seq
MIRT1968037	hsa-miR-26b	CLIP-seq
MIRT2507143	hsa-miR-3122	CLIP-seq
MIRT2507144	hsa-miR-3127-3p	CLIP-seq
MIRT904066	hsa-miR-3154	CLIP-seq
MIRT904067	hsa-miR-3158-3p	CLIP-seq
MIRT2507145	hsa-miR-3190	CLIP-seq
MIRT1968040	hsa-miR-339-5p	CLIP-seq
MIRT904070	hsa-miR-3671	CLIP-seq
MIRT2507146	hsa-miR-3691-3p	CLIP-seq
MIRT904071	hsa-miR-371-3p	CLIP-seq
MIRT904072	hsa-miR-371b-3p	CLIP-seq
MIRT2507147	hsa-miR-3913-5p	CLIP-seq
MIRT904074	hsa-miR-3922-5p	CLIP-seq
MIRT2507148	hsa-miR-4280	CLIP-seq
MIRT2507149	hsa-miR-4290	CLIP-seq
MIRT904075	hsa-miR-4302	CLIP-seq
MIRT904076	hsa-miR-4303	CLIP-seq
MIRT2507150	hsa-miR-4420	CLIP-seq
MIRT2507151	hsa-miR-4423-5p	CLIP-seq
MIRT1968042	hsa-miR-4465	CLIP-seq
MIRT2507152	hsa-miR-4469	CLIP-seq
MIRT2507153	hsa-miR-450b-3p	CLIP-seq
MIRT2507154	hsa-miR-4514	CLIP-seq
MIRT2507155	hsa-miR-4529-3p	CLIP-seq
MIRT2203952	hsa-miR-4639-5p	CLIP-seq
MIRT1968045	hsa-miR-4690-3p	CLIP-seq
MIRT2507156	hsa-miR-4690-5p	CLIP-seq
MIRT2507157	hsa-miR-4692	CLIP-seq
MIRT904080	hsa-miR-4708-3p	CLIP-seq
MIRT2507158	hsa-miR-4709-3p	CLIP-seq
MIRT1968046	hsa-miR-4711-5p	CLIP-seq
MIRT2678461	hsa-miR-4744	CLIP-seq
MIRT904081	hsa-miR-4753-5p	CLIP-seq
MIRT2507159	hsa-miR-4768-5p	CLIP-seq
MIRT2507160	hsa-miR-4786-5p	CLIP-seq
MIRT2507161	hsa-miR-513c	CLIP-seq
MIRT2507162	hsa-miR-514b-5p	CLIP-seq
MIRT904082	hsa-miR-515-3p	CLIP-seq
MIRT904083	hsa-miR-519e	CLIP-seq
MIRT904084	hsa-miR-522	CLIP-seq
MIRT2678462	hsa-miR-548u	CLIP-seq
MIRT904085	hsa-miR-607	CLIP-seq
MIRT904086	hsa-miR-615-5p	CLIP-seq
MIRT2507163	hsa-miR-671-5p	CLIP-seq
MIRT2507164	hsa-miR-769-3p	CLIP-seq

22 Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000338	Process	Protein deneddylation	IDA	19141280
GO:0000338	Process	Protein deneddylation	IEA
GO:0005515	Function	Protein binding	IPI	16169070, 17337451, 18850735, 19615732, 20399188, 21145461, 21625211, 24421388, 25043011, 26030138, 26267535, 26456823, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	24421388
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	24421388
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0008180	Component	COP9 signalosome	IBA
GO:0008180	Component	COP9 signalosome	IDA	18850735
GO:0008180	Component	COP9 signalosome	IEA
GO:0008180	Component	COP9 signalosome	IPI	25043011
GO:0008180	Component	COP9 signalosome	ISS
GO:0008233	Function	Peptidase activity	IKR	17559875
GO:0045116	Process	Protein neddylation	NAS	24421388
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0140492	Function	Metal-dependent deubiquitinase activity	IKR	17559875
GO:2000434	Process	Regulation of protein neddylation	NAS	24421388

MIM	HGNC	e!Ensembl
614729	21749	ENSG00000168090

Q7L5N1

Protein name

COP9 signalosome complex subunit 6 (SGN6) (Signalosome subunit 6) (JAB1-containing signalosome subunit 6) (MOV34 homolog) (Vpr-interacting protein) (hVIP)

Protein function

Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the culli

PDB

4D10 , 4D18 , 4QFT , 4R14 , 4WSN , 6R6H , 6R7F , 6R7H , 6R7I , 8H38 , 8H3A , 8H3F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01398	JAB	36 → 148	JAB1/Mov34/MPN/PAD-1 ubiquitin protease	Family
PF13012	MitMem_reg	194 → 307	Maintenance of mitochondrial structure and function	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9520381}.

Sequence

MAAAAAAAAATNGTGGSSGMEVDAAVVPSVMACGVTGSVSVALHPLVILNISDHWIRMRS
QEGRPVQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELE
FLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEAT
MLFAELTYTLATEEAERIGVDHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILE
YVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCN
TMNQFVNKFNVLYDRQGIGRRMRGLFF

Sequence length

327

Interactions

View interactions

Reactome Pathway
DNA Damage Recognition in GG-NER
Formation of TC-NER Pre-Incision Complex
Cargo recognition for clathrin-mediated endocytosis
Neddylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (36)
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29707311		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31311398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31339657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31339657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27748879, 32225170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31339657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31311398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	26318036, 31223289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26318036, 31223289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	29707311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26267535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26267535, 31339657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31339657, 32225170, 37202390, 37457886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33179082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27546621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27546621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31422034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35311290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32495877	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31339657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31311398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31565481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25945542, 27546621, 30961513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	26318036, 31223289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26267535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21317535, 29341469, 31311398, 31565481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31311398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31311398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31311398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29341469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	31339657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32495877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31565481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21317535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	31339657	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31223289	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

COPS6 (COP9 signalosome subunit 6)

Bookmark This Gene