COL23A1 (collagen type XXIII alpha 1 chain)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 91522
• Gene name: Collagen type XXIII alpha 1 chain
• Gene symbol: COL23A1
• Synonyms (NCBI Gene): -
• Chromosome: 5
• Chromosome location: 5q35.3
• Summary: COL23A1 is a member of the transmembrane collagens, a subfamily of the nonfibrillar collagens that contain a single pass hydrophobic transmembrane domain (Banyard et al., 2003 [PubMed 12644459]).[supplied by OMIM, Mar 2008]

miRNA Show/Hide all (293)

miRTarBase ID	miRNA	Experiments	Reference
MIRT499047	hsa-miR-4438	PAR-CLIP	20371350
MIRT499045	hsa-miR-501-3p	PAR-CLIP	20371350
MIRT499046	hsa-miR-502-3p	PAR-CLIP	20371350
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	20371350
MIRT499040	hsa-miR-767-5p	PAR-CLIP	20371350
MIRT499041	hsa-miR-5095	PAR-CLIP	20371350
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	20371350
MIRT499048	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT499047	hsa-miR-4438	PAR-CLIP	20371350
MIRT499045	hsa-miR-501-3p	PAR-CLIP	20371350
MIRT499046	hsa-miR-502-3p	PAR-CLIP	20371350
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	20371350
MIRT499040	hsa-miR-767-5p	PAR-CLIP	20371350
MIRT499041	hsa-miR-5095	PAR-CLIP	20371350
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	20371350
MIRT454627	hsa-miR-4714-3p	PAR-CLIP	20371350
MIRT454623	hsa-miR-4680-5p	PAR-CLIP	20371350
MIRT454622	hsa-miR-8086	PAR-CLIP	20371350
MIRT454621	hsa-miR-4474-5p	PAR-CLIP	20371350
MIRT454620	hsa-miR-676-5p	PAR-CLIP	20371350
MIRT499048	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT499047	hsa-miR-4438	PAR-CLIP	20371350
MIRT499045	hsa-miR-501-3p	PAR-CLIP	20371350
MIRT499046	hsa-miR-502-3p	PAR-CLIP	20371350
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	20371350
MIRT499040	hsa-miR-767-5p	PAR-CLIP	20371350
MIRT499041	hsa-miR-5095	PAR-CLIP	20371350
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	20371350
MIRT499048	hsa-miR-32-3p	PAR-CLIP	21572407
MIRT499047	hsa-miR-4438	PAR-CLIP	21572407
MIRT499045	hsa-miR-501-3p	PAR-CLIP	21572407
MIRT499046	hsa-miR-502-3p	PAR-CLIP	21572407
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	21572407
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	21572407
MIRT499040	hsa-miR-767-5p	PAR-CLIP	21572407
MIRT499041	hsa-miR-5095	PAR-CLIP	21572407
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	21572407
MIRT499048	hsa-miR-32-3p	PAR-CLIP	21572407
MIRT499047	hsa-miR-4438	PAR-CLIP	21572407
MIRT499045	hsa-miR-501-3p	PAR-CLIP	21572407
MIRT499046	hsa-miR-502-3p	PAR-CLIP	21572407
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	21572407
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	21572407
MIRT499040	hsa-miR-767-5p	PAR-CLIP	21572407
MIRT499041	hsa-miR-5095	PAR-CLIP	21572407
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	21572407
MIRT454627	hsa-miR-4714-3p	PAR-CLIP	22012620
MIRT454626	hsa-miR-3155a	PAR-CLIP	22012620
MIRT454625	hsa-miR-3155b	PAR-CLIP	22012620
MIRT454624	hsa-miR-484	PAR-CLIP	22012620
MIRT454623	hsa-miR-4680-5p	PAR-CLIP	22012620
MIRT454622	hsa-miR-8086	PAR-CLIP	22012620
MIRT454621	hsa-miR-4474-5p	PAR-CLIP	22012620
MIRT454620	hsa-miR-676-5p	PAR-CLIP	22012620
MIRT499047	hsa-miR-4438	PAR-CLIP	22012620
MIRT499045	hsa-miR-501-3p	PAR-CLIP	22012620
MIRT499046	hsa-miR-502-3p	PAR-CLIP	22012620
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	22012620
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	22012620
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	22012620
MIRT499040	hsa-miR-767-5p	PAR-CLIP	22012620
MIRT499041	hsa-miR-5095	PAR-CLIP	22012620
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	22012620
MIRT499047	hsa-miR-4438	PAR-CLIP	23446348
MIRT499045	hsa-miR-501-3p	PAR-CLIP	23446348
MIRT499046	hsa-miR-502-3p	PAR-CLIP	23446348
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT499040	hsa-miR-767-5p	PAR-CLIP	23446348
MIRT499041	hsa-miR-5095	PAR-CLIP	23446348
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT454627	hsa-miR-4714-3p	PAR-CLIP	23446348
MIRT454623	hsa-miR-4680-5p	PAR-CLIP	23446348
MIRT454622	hsa-miR-8086	PAR-CLIP	23446348
MIRT454621	hsa-miR-4474-5p	PAR-CLIP	23446348
MIRT454620	hsa-miR-676-5p	PAR-CLIP	23446348
MIRT499047	hsa-miR-4438	PAR-CLIP	23446348
MIRT499045	hsa-miR-501-3p	PAR-CLIP	23446348
MIRT499046	hsa-miR-502-3p	PAR-CLIP	23446348
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT499040	hsa-miR-767-5p	PAR-CLIP	23446348
MIRT499041	hsa-miR-5095	PAR-CLIP	23446348
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT499048	hsa-miR-32-3p	PAR-CLIP	23446348
MIRT499047	hsa-miR-4438	PAR-CLIP	23446348
MIRT499045	hsa-miR-501-3p	PAR-CLIP	23446348
MIRT499046	hsa-miR-502-3p	PAR-CLIP	23446348
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT499040	hsa-miR-767-5p	PAR-CLIP	23446348
MIRT499041	hsa-miR-5095	PAR-CLIP	23446348
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT499048	hsa-miR-32-3p	PAR-CLIP	23446348
MIRT499047	hsa-miR-4438	PAR-CLIP	23446348
MIRT499045	hsa-miR-501-3p	PAR-CLIP	23446348
MIRT499046	hsa-miR-502-3p	PAR-CLIP	23446348
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT499040	hsa-miR-767-5p	PAR-CLIP	23446348
MIRT499041	hsa-miR-5095	PAR-CLIP	23446348
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT499048	hsa-miR-32-3p	PAR-CLIP	24398324
MIRT499047	hsa-miR-4438	PAR-CLIP	24398324
MIRT499045	hsa-miR-501-3p	PAR-CLIP	24398324
MIRT499046	hsa-miR-502-3p	PAR-CLIP	24398324
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	24398324
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	24398324
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	24398324
MIRT499040	hsa-miR-767-5p	PAR-CLIP	24398324
MIRT499041	hsa-miR-5095	PAR-CLIP	24398324
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	24398324
MIRT454627	hsa-miR-4714-3p	PAR-CLIP	23592263
MIRT454623	hsa-miR-4680-5p	PAR-CLIP	23592263
MIRT454622	hsa-miR-8086	PAR-CLIP	23592263
MIRT454621	hsa-miR-4474-5p	PAR-CLIP	23592263
MIRT454620	hsa-miR-676-5p	PAR-CLIP	23592263
MIRT454627	hsa-miR-4714-3p	PAR-CLIP	23592263
MIRT454626	hsa-miR-3155a	PAR-CLIP	23592263
MIRT454625	hsa-miR-3155b	PAR-CLIP	23592263
MIRT454624	hsa-miR-484	PAR-CLIP	23592263
MIRT454623	hsa-miR-4680-5p	PAR-CLIP	23592263
MIRT454622	hsa-miR-8086	PAR-CLIP	23592263
MIRT454621	hsa-miR-4474-5p	PAR-CLIP	23592263
MIRT454620	hsa-miR-676-5p	PAR-CLIP	23592263
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	27292025
MIRT499048	hsa-miR-32-3p	PAR-CLIP	27292025
MIRT499047	hsa-miR-4438	PAR-CLIP	27292025
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	27292025
MIRT499045	hsa-miR-501-3p	PAR-CLIP	27292025
MIRT499046	hsa-miR-502-3p	PAR-CLIP	27292025
MIRT499041	hsa-miR-5095	PAR-CLIP	27292025
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	27292025
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	27292025
MIRT499040	hsa-miR-767-5p	PAR-CLIP	27292025
MIRT499047	hsa-miR-4438	PAR-CLIP	20371350
MIRT499045	hsa-miR-501-3p	PAR-CLIP	20371350
MIRT499046	hsa-miR-502-3p	PAR-CLIP	20371350
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	20371350
MIRT499040	hsa-miR-767-5p	PAR-CLIP	20371350
MIRT499041	hsa-miR-5095	PAR-CLIP	20371350
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	20371350
MIRT499048	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT499047	hsa-miR-4438	PAR-CLIP	20371350
MIRT499045	hsa-miR-501-3p	PAR-CLIP	20371350
MIRT499046	hsa-miR-502-3p	PAR-CLIP	20371350
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	20371350
MIRT499040	hsa-miR-767-5p	PAR-CLIP	20371350
MIRT499041	hsa-miR-5095	PAR-CLIP	20371350
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	20371350
MIRT454627	hsa-miR-4714-3p	PAR-CLIP	20371350
MIRT454623	hsa-miR-4680-5p	PAR-CLIP	20371350
MIRT454622	hsa-miR-8086	PAR-CLIP	20371350
MIRT454621	hsa-miR-4474-5p	PAR-CLIP	20371350
MIRT454620	hsa-miR-676-5p	PAR-CLIP	20371350
MIRT499048	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT499047	hsa-miR-4438	PAR-CLIP	20371350
MIRT499045	hsa-miR-501-3p	PAR-CLIP	20371350
MIRT499046	hsa-miR-502-3p	PAR-CLIP	20371350
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	20371350
MIRT499040	hsa-miR-767-5p	PAR-CLIP	20371350
MIRT499041	hsa-miR-5095	PAR-CLIP	20371350
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	20371350
MIRT499048	hsa-miR-32-3p	PAR-CLIP	21572407
MIRT499047	hsa-miR-4438	PAR-CLIP	21572407
MIRT499045	hsa-miR-501-3p	PAR-CLIP	21572407
MIRT499046	hsa-miR-502-3p	PAR-CLIP	21572407
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	21572407
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	21572407
MIRT499040	hsa-miR-767-5p	PAR-CLIP	21572407
MIRT499041	hsa-miR-5095	PAR-CLIP	21572407
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	21572407
MIRT499048	hsa-miR-32-3p	PAR-CLIP	21572407
MIRT499047	hsa-miR-4438	PAR-CLIP	21572407
MIRT499045	hsa-miR-501-3p	PAR-CLIP	21572407
MIRT499046	hsa-miR-502-3p	PAR-CLIP	21572407
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	21572407
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	21572407
MIRT499040	hsa-miR-767-5p	PAR-CLIP	21572407
MIRT499041	hsa-miR-5095	PAR-CLIP	21572407
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	21572407
MIRT454627	hsa-miR-4714-3p	PAR-CLIP	22012620
MIRT454626	hsa-miR-3155a	PAR-CLIP	22012620
MIRT454625	hsa-miR-3155b	PAR-CLIP	22012620
MIRT454624	hsa-miR-484	PAR-CLIP	22012620
MIRT454623	hsa-miR-4680-5p	PAR-CLIP	22012620
MIRT454622	hsa-miR-8086	PAR-CLIP	22012620
MIRT454621	hsa-miR-4474-5p	PAR-CLIP	22012620
MIRT454620	hsa-miR-676-5p	PAR-CLIP	22012620
MIRT499047	hsa-miR-4438	PAR-CLIP	22012620
MIRT499045	hsa-miR-501-3p	PAR-CLIP	22012620
MIRT499046	hsa-miR-502-3p	PAR-CLIP	22012620
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	22012620
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	22012620
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	22012620
MIRT499040	hsa-miR-767-5p	PAR-CLIP	22012620
MIRT499041	hsa-miR-5095	PAR-CLIP	22012620
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	22012620
MIRT499047	hsa-miR-4438	PAR-CLIP	23446348
MIRT499045	hsa-miR-501-3p	PAR-CLIP	23446348
MIRT499046	hsa-miR-502-3p	PAR-CLIP	23446348
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT499040	hsa-miR-767-5p	PAR-CLIP	23446348
MIRT499041	hsa-miR-5095	PAR-CLIP	23446348
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT454627	hsa-miR-4714-3p	PAR-CLIP	23446348
MIRT454623	hsa-miR-4680-5p	PAR-CLIP	23446348
MIRT454622	hsa-miR-8086	PAR-CLIP	23446348
MIRT454621	hsa-miR-4474-5p	PAR-CLIP	23446348
MIRT454620	hsa-miR-676-5p	PAR-CLIP	23446348
MIRT499047	hsa-miR-4438	PAR-CLIP	23446348
MIRT499045	hsa-miR-501-3p	PAR-CLIP	23446348
MIRT499046	hsa-miR-502-3p	PAR-CLIP	23446348
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT499040	hsa-miR-767-5p	PAR-CLIP	23446348
MIRT499041	hsa-miR-5095	PAR-CLIP	23446348
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT499048	hsa-miR-32-3p	PAR-CLIP	23446348
MIRT499047	hsa-miR-4438	PAR-CLIP	23446348
MIRT499045	hsa-miR-501-3p	PAR-CLIP	23446348
MIRT499046	hsa-miR-502-3p	PAR-CLIP	23446348
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT499040	hsa-miR-767-5p	PAR-CLIP	23446348
MIRT499041	hsa-miR-5095	PAR-CLIP	23446348
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT499048	hsa-miR-32-3p	PAR-CLIP	23446348
MIRT499047	hsa-miR-4438	PAR-CLIP	23446348
MIRT499045	hsa-miR-501-3p	PAR-CLIP	23446348
MIRT499046	hsa-miR-502-3p	PAR-CLIP	23446348
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT499040	hsa-miR-767-5p	PAR-CLIP	23446348
MIRT499041	hsa-miR-5095	PAR-CLIP	23446348
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT499048	hsa-miR-32-3p	PAR-CLIP	24398324
MIRT499047	hsa-miR-4438	PAR-CLIP	24398324
MIRT499045	hsa-miR-501-3p	PAR-CLIP	24398324
MIRT499046	hsa-miR-502-3p	PAR-CLIP	24398324
MIRT499044	hsa-miR-6504-3p	PAR-CLIP	24398324
MIRT499043	hsa-miR-1224-3p	PAR-CLIP	24398324
MIRT499042	hsa-miR-4735-5p	PAR-CLIP	24398324
MIRT499040	hsa-miR-767-5p	PAR-CLIP	24398324
MIRT499041	hsa-miR-5095	PAR-CLIP	24398324
MIRT499039	hsa-miR-7151-3p	PAR-CLIP	24398324
MIRT454627	hsa-miR-4714-3p	PAR-CLIP	23592263
MIRT454623	hsa-miR-4680-5p	PAR-CLIP	23592263
MIRT454622	hsa-miR-8086	PAR-CLIP	23592263
MIRT454621	hsa-miR-4474-5p	PAR-CLIP	23592263
MIRT454620	hsa-miR-676-5p	PAR-CLIP	23592263
MIRT454627	hsa-miR-4714-3p	PAR-CLIP	23592263
MIRT454626	hsa-miR-3155a	PAR-CLIP	23592263
MIRT454625	hsa-miR-3155b	PAR-CLIP	23592263
MIRT454624	hsa-miR-484	PAR-CLIP	23592263
MIRT454623	hsa-miR-4680-5p	PAR-CLIP	23592263
MIRT454622	hsa-miR-8086	PAR-CLIP	23592263
MIRT454621	hsa-miR-4474-5p	PAR-CLIP	23592263
MIRT454620	hsa-miR-676-5p	PAR-CLIP	23592263
MIRT1967719	hsa-miR-4693-3p	CLIP-seq
MIRT2203539	hsa-miR-4643	CLIP-seq
MIRT2203540	hsa-miR-466	CLIP-seq
MIRT2203541	hsa-miR-4749-3p	CLIP-seq
MIRT2203542	hsa-miR-4789-3p	CLIP-seq
MIRT2203539	hsa-miR-4643	CLIP-seq
MIRT2203540	hsa-miR-466	CLIP-seq
MIRT2203541	hsa-miR-4749-3p	CLIP-seq
MIRT2203542	hsa-miR-4789-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005581	Component	Collagen trimer	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0008201	Function	Heparin binding	IEA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0030020	Function	Extracellular matrix structural constituent conferring tensile strength	IBA
GO:0030020	Function	Extracellular matrix structural constituent conferring tensile strength	RCA	25037231
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0031012	Component	Extracellular matrix	IBA
GO:0042802	Function	Identical protein binding	IEA

Other IDs

• MIM: 610043
• HGNC: 22990
• e!Ensembl: ENSG00000050767

Protein

• UniProt ID: Q86Y22
• Protein name: Collagen alpha-1(XXIII) chain
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01391	Collagen	317 → 377	Collagen triple helix repeat (20 copies)	Repeat
  PF01391	Collagen	250 → 307	Collagen triple helix repeat (20 copies)	Repeat
  PF01391	Collagen	410 → 471	Collagen triple helix repeat (20 copies)	Repeat
  PF01391	Collagen	463 → 532	Collagen triple helix repeat (20 copies)	Repeat
  PF01391	Collagen	342 → 400	Collagen triple helix repeat (20 copies)	Repeat
  PF01391	Collagen	117 → 173	Collagen triple helix repeat (20 copies)	Repeat
  PF01391	Collagen	196 → 257	Collagen triple helix repeat (20 copies)	Repeat

• Sequence:

  MGPGERAGGGGDAGKGNAAGGGGGGRSATTAGSRAVSALCLLLSVGSAAACLLLGVQAAA
  LQGRVAALEEERELLRRAGPPGALDAWAEPHLERLLREKLDGLAKIRTAREAPSECVCPP
  GPPGRRGKPGRRGDPGPPGQSGRDGYPGPLGLDGKPGLPGPKGEKGAPGDFGPRGDQGQD
  GAAGPPGPPGPPGARGPPGDTGKDGPRGAQGPAGPKGEPGQDGEMGPKGPPGPKGEPGVP
  GKKGDDGTPSQPGPPGPKGEPGSMGPRGENGVDGAPGPKGEPGHRGTDGAAGPRGAPGLK
  GEQGDTVVIDYDGRILDALKGPPGPQGPPGPPGIPGAKGELGLPGAPGIDGEKGPKGQKG
  DPGEPGPAGLKGEAGEMGLSGLPGADGLKGEKGESASDSLQESLAQLIVEPGPPGPPGPP
  GPMGLQGIQGPKGLDGAKGEKGASGERGPSGLPGPVGPPGLIGLPGTKGEKGRPGEPGLD
  GFPGPRGEKGDRSERGEKGERGVPGRKGVKGQKGEPGPPGLDQPCPVGPDGLPVPGCWHK
  

• Sequence length: 540

Pathways

KEGG Pathway	Reactome Pathway
Protein digestion and absorption	Collagen biosynthesis and modifying enzymes
	Collagen chain trimerization

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (16)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	30573740	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BULIMIA NERVOSA	—	GWAS catalog	23568457	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC EMBOLISM	—	GWAS catalog	34031191	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	34031191	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	34343768	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	29892016, 33398198, 37945903, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, FAMILIAL	—	CTD	29892016	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	29892016, 33398198, 37945903, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	38469033	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular endothelial growth factor (VEGF) inhibitor response	association	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (10)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27936202	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28852123, 29651135		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	38163849	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28852123		★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	CTD_human_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	29892016		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Diffuse	Scleroderma	Pubtator	24812288	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	34167437	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

C16orf95 3 shared diseasesCardiac embolism, Cardioembolic stroke, Psychiatric disorders 3 shared evidence sourcesGWAS catalog (Cardiac embolism), GWAS catalog (Cardioembolic stroke), GWAS catalog (Psychiatric disorders) Related via 3 shared diseases including Cardiac embolism, Cardioembolic stroke — evidence mostly GWAS catalog. MIDEAS 2 shared diseasesCardiac embolism, Cardioembolic stroke 2 shared evidence sourcesGWAS catalog (Cardiac embolism), GWAS catalog (Cardioembolic stroke) Related via 2 shared diseases including Cardiac embolism, Cardioembolic stroke — evidence mostly GWAS catalog. NRN1 2 shared diseasesCardiac embolism, Cardioembolic stroke 2 shared evidence sourcesGWAS catalog (Cardiac embolism), GWAS catalog (Cardioembolic stroke) Related via 2 shared diseases including Cardiac embolism, Cardioembolic stroke — evidence mostly GWAS catalog. OR4D1 2 shared diseasesCardiac embolism, Cardioembolic stroke 2 shared evidence sourcesGWAS catalog (Cardiac embolism), GWAS catalog (Cardioembolic stroke) Related via 2 shared diseases including Cardiac embolism, Cardioembolic stroke — evidence mostly GWAS catalog. OR4D2 2 shared diseasesCardiac embolism, Cardioembolic stroke 2 shared evidence sourcesGWAS catalog (Cardiac embolism), GWAS catalog (Cardioembolic stroke) Related via 2 shared diseases including Cardiac embolism, Cardioembolic stroke — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
C16orf95	3	["Cardiac embolism","Cardioembolic stroke","Psychiatric disorders"]	0	[]	3	["GWAS catalog (Cardiac embolism)","GWAS catalog (Cardioembolic stroke)","GWAS catalog (Psychiatric disorders)"]
MIDEAS	2	["Cardiac embolism","Cardioembolic stroke"]	0	[]	2	["GWAS catalog (Cardiac embolism)","GWAS catalog (Cardioembolic stroke)"]
NRN1	2	["Cardiac embolism","Cardioembolic stroke"]	0	[]	2	["GWAS catalog (Cardiac embolism)","GWAS catalog (Cardioembolic stroke)"]
OR4D1	2	["Cardiac embolism","Cardioembolic stroke"]	0	[]	2	["GWAS catalog (Cardiac embolism)","GWAS catalog (Cardioembolic stroke)"]
OR4D2	2	["Cardiac embolism","Cardioembolic stroke"]	0	[]	2	["GWAS catalog (Cardiac embolism)","GWAS catalog (Cardioembolic stroke)"]

Diseases Linked via Similar Genes

Dementia Linked via 2 of 5 related genesOR4D1, OR4D2 Alzheimer disease Linked via 1 of 5 related genesC16orf95 Breast cancer Linked via 1 of 5 related genesC16orf95 Congenital left-sided heart lesions Linked via 1 of 5 related genesC16orf95 Hypertension Linked via 1 of 5 related genesC16orf95

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Dementia	2	["OR4D1","OR4D2"]
Alzheimer disease	1	["C16orf95"]
Breast cancer	1	["C16orf95"]
Congenital left-sided heart lesions	1	["C16orf95"]
Hypertension	1	["C16orf95"]