Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	84319
Gene name	Cms1 ribosomal small subunit homolog
Gene symbol	CMSS1
Synonyms (NCBI Gene)	C3orf26
Chromosome	3
Chromosome location	3q12.1

57 Show/Hide all (57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020861	hsa-miR-155-5p	Proteomics	18668040
MIRT526945	hsa-miR-4323	PAR-CLIP	20371350
MIRT526946	hsa-miR-4687-5p	PAR-CLIP	20371350
MIRT526944	hsa-miR-4758-3p	PAR-CLIP	20371350
MIRT526943	hsa-miR-4290	PAR-CLIP	20371350
MIRT526945	hsa-miR-4323	PAR-CLIP	22012620
MIRT526946	hsa-miR-4687-5p	PAR-CLIP	22012620
MIRT526944	hsa-miR-4758-3p	PAR-CLIP	22012620
MIRT526943	hsa-miR-4290	PAR-CLIP	22012620
MIRT526942	hsa-miR-5196-3p	PAR-CLIP	22012620
MIRT526941	hsa-miR-5193	PAR-CLIP	22012620
MIRT526940	hsa-miR-660-3p	PAR-CLIP	22012620
MIRT526939	hsa-miR-4324	PAR-CLIP	22012620
MIRT526938	hsa-miR-544b	PAR-CLIP	22012620
MIRT526937	hsa-miR-486-5p	PAR-CLIP	22012620
MIRT526936	hsa-miR-4649-3p	PAR-CLIP	22012620
MIRT526935	hsa-miR-5008-5p	PAR-CLIP	22012620
MIRT526934	hsa-miR-6089	PAR-CLIP	22012620
MIRT526933	hsa-miR-6778-3p	PAR-CLIP	22012620
MIRT526932	hsa-miR-2355-5p	PAR-CLIP	22012620
MIRT526931	hsa-miR-1200	PAR-CLIP	22012620
MIRT444719	hsa-miR-548e-5p	PAR-CLIP	22100165
MIRT444718	hsa-miR-4282	PAR-CLIP	22100165
MIRT444717	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT444716	hsa-miR-3163	PAR-CLIP	22100165
MIRT444719	hsa-miR-548e-5p	PAR-CLIP	22100165
MIRT444718	hsa-miR-4282	PAR-CLIP	22100165
MIRT444717	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT444716	hsa-miR-3163	PAR-CLIP	22100165
MIRT526945	hsa-miR-4323	PAR-CLIP	20371350
MIRT526946	hsa-miR-4687-5p	PAR-CLIP	20371350
MIRT526944	hsa-miR-4758-3p	PAR-CLIP	20371350
MIRT526943	hsa-miR-4290	PAR-CLIP	20371350
MIRT526945	hsa-miR-4323	PAR-CLIP	22012620
MIRT526946	hsa-miR-4687-5p	PAR-CLIP	22012620
MIRT526944	hsa-miR-4758-3p	PAR-CLIP	22012620
MIRT526943	hsa-miR-4290	PAR-CLIP	22012620
MIRT526942	hsa-miR-5196-3p	PAR-CLIP	22012620
MIRT526941	hsa-miR-5193	PAR-CLIP	22012620
MIRT526940	hsa-miR-660-3p	PAR-CLIP	22012620
MIRT526939	hsa-miR-4324	PAR-CLIP	22012620
MIRT526938	hsa-miR-544b	PAR-CLIP	22012620
MIRT526937	hsa-miR-486-5p	PAR-CLIP	22012620
MIRT526936	hsa-miR-4649-3p	PAR-CLIP	22012620
MIRT526935	hsa-miR-5008-5p	PAR-CLIP	22012620
MIRT526934	hsa-miR-6089	PAR-CLIP	22012620
MIRT526933	hsa-miR-6778-3p	PAR-CLIP	22012620
MIRT526932	hsa-miR-2355-5p	PAR-CLIP	22012620
MIRT526931	hsa-miR-1200	PAR-CLIP	22012620
MIRT444719	hsa-miR-548e-5p	PAR-CLIP	22100165
MIRT444718	hsa-miR-4282	PAR-CLIP	22100165
MIRT444717	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT444716	hsa-miR-3163	PAR-CLIP	22100165
MIRT444719	hsa-miR-548e-5p	PAR-CLIP	22100165
MIRT444718	hsa-miR-4282	PAR-CLIP	22100165
MIRT444717	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT444716	hsa-miR-3163	PAR-CLIP	22100165

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	32814053

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9BQ75

Protein name

Protein CMSS1 (Cms1 ribosomal small subunit homolog)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14617	CMS1	45 → 275	U3-containing 90S pre-ribosomal complex subunit	Family

Sequence

MADDLGDEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQP
KERKENTTKTRKRRKKKITDVLAKSEPKPGLPEDLQKLMKDYYSSRRLVIELEELNLPDS
CFLKANDLTHSLSSYLKEICPKWVKLRKNHSEKKSVLMLIICSSAVRALELIRSMTAFRG
DGKVIKLFAKHIKVQAQVKLLEKRVVHLGVGTPGRIKELVKQGGLNLSPLKFLVFDWNWR
DQKLRRMMDIPEIRKEVFELLEMGVLSLCKSESLKLGLF

Sequence length

279

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (16)
ANEMIA	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	40645996	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	29059683, 32139696, 32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	29059683, 32139696, 32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CMSS1-related disorder	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	22863734	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	22751097	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	26485405	★★★★★ ★☆☆☆☆ Found in Text Mining only

CMSS1 (cms1 ribosomal small subunit homolog)

Bookmark This Gene