CLDN34 (claudin 34)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100288814
Gene name Claudin 34
Gene symbol CLDN34
Synonyms (NCBI Gene)
-
Chromosome X
Chromosome location Xp22.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005198 Function Structural molecule activity IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005923 Component Bicellular tight junction IBA
GO:0005923 Component Bicellular tight junction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
H7C241
Protein name Claudin-34
Protein function Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Family and domains
Sequence 
MVWFCNSADCQFSVFALTTIGWILSSTSTGLVEWRIWYMKDTSLYPPGIACVGIFRVCIY
RRRTNSTTTKFCYRYSYQDTFLPFEISMAQRFLLTASIFGFFGRAFNMFALRNMSMRMFE
EDTYNSFVVSGILNIAAGVFNLIAVLQNYDAVINSQGITFLPSLQMPFKPDVQEVGTAIQ
VAGIGVLPMLLTGMFSLFYKCPPYGQVHPGISEM
Sequence length 214
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Virion - Hepatitis viruses
Cell adhesion molecules
Tight junction
Leukocyte transendothelial migration
Pathogenic Escherichia coli infection
Hepatitis C
Sort by:
CLDN24 6 shared pathwaysVirion - Hepatitis viruses, Cell adhesion molecules, Tight junction, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Hepatitis C Related via 6 shared pathways including Virion - Hepatitis viruses, Cell adhesion molecules. CLDN16 6 shared pathwaysVirion - Hepatitis viruses, Cell adhesion molecules, Tight junction, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Hepatitis C Related via 6 shared pathways including Virion - Hepatitis viruses, Cell adhesion molecules. CLDN4 6 shared pathwaysVirion - Hepatitis viruses, Cell adhesion molecules, Tight junction, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Hepatitis C Related via 6 shared pathways including Virion - Hepatitis viruses, Cell adhesion molecules. CLDN3 6 shared pathwaysVirion - Hepatitis viruses, Cell adhesion molecules, Tight junction, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Hepatitis C Related via 6 shared pathways including Virion - Hepatitis viruses, Cell adhesion molecules. CLDN7 6 shared pathwaysVirion - Hepatitis viruses, Cell adhesion molecules, Tight junction, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Hepatitis C Related via 6 shared pathways including Virion - Hepatitis viruses, Cell adhesion molecules.
Polycystic ovary syndrome Linked via 2 of 5 related genesCLDN16, CLDN4 Rhinitis Linked via 2 of 5 related genesCLDN3, CLDN7 Prostatic neoplasms Linked via 2 of 5 related genesCLDN3, CLDN7 Jeune syndrome Linked via 1 of 5 related genesCLDN24 Major depressive disorder Linked via 1 of 5 related genesCLDN24