CLDN23 (claudin 23)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 137075
• Gene name: Claudin 23
• Gene symbol: CLDN23
• Synonyms (NCBI Gene): CLDNL, hCG1646163
• Chromosome: 8
• Chromosome location: 8p23.1
• Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellula

miRNA Show/Hide all (18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046704	hsa-miR-222-3p	CLASH	23622248
MIRT045021	hsa-miR-186-5p	CLASH	23622248
MIRT895346	hsa-miR-105	CLIP-seq
MIRT895347	hsa-miR-3658	CLIP-seq
MIRT895348	hsa-miR-4693-3p	CLIP-seq
MIRT895349	hsa-miR-4696	CLIP-seq
MIRT895350	hsa-miR-4715-3p	CLIP-seq
MIRT895351	hsa-miR-4757-5p	CLIP-seq
MIRT895352	hsa-miR-526b	CLIP-seq
MIRT895353	hsa-miR-587	CLIP-seq
MIRT895354	hsa-miR-760	CLIP-seq
MIRT1546456	hsa-miR-1289	CLIP-seq
MIRT1546457	hsa-miR-133a	CLIP-seq
MIRT1546458	hsa-miR-133b	CLIP-seq
MIRT2201433	hsa-miR-1255a	CLIP-seq
MIRT2201434	hsa-miR-1255b	CLIP-seq
MIRT2201435	hsa-miR-3186-5p	CLIP-seq
MIRT2201436	hsa-miR-3197	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005198	Function	Structural molecule activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005923	Component	Bicellular tight junction	IBA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005923	Component	Bicellular tight junction	ISS
GO:0007155	Process	Cell adhesion	IBA
GO:0016020	Component	Membrane	IEA
GO:0016338	Process	Calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	ISS
GO:0042802	Function	Identical protein binding	ISS
GO:0070161	Component	Anchoring junction	IEA
GO:0070830	Process	Bicellular tight junction assembly	IBA

Other IDs

• MIM: 609203
• HGNC: 17591
• e!Ensembl: ENSG00000253958

Protein

• UniProt ID: Q96B33
• Protein name: Claudin-23
• Protein function: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00822	PMP22_Claudin	3 → 177	PMP-22/EMP/MP20/Claudin family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in germinal center B-cells, placenta, stomach as well as in colon tumor. {ECO:0000269|PubMed:12736707}.
• Sequence:

  MRTPVVMTLGMVLAPCGLLLNLTGTLAPGWRLVKGFLNQPVDVELYQGLWDMCREQSSRE
  RECGQTDQWGYFEAQPVLVARALMVTSLAATVLGLLLASLGVRCWQDEPNFVLAGLSGVV
  LFVAGLLGLIPVSWYNHFLGDRDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALS
  FAPWCDERCRRRRKGPSAGPRRSSVSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPK
  PKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTHPCDSSLPCDSDL

• Sequence length: 292

Pathways

KEGG Pathway

Virion - Hepatitis viruses

Cell adhesion molecules

Tight junction

Leukocyte transendothelial migration

Pathogenic Escherichia coli infection

Hepatitis C

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (14)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTHMA	—	GWAS catalog	35472084	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	35915156	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	35472084	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	31578528	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	33859377	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	29255261	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	30664745, 36889626	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	30664745	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTOSCLEROSIS	—	GWAS catalog	36653343	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	33398198, 37945903	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	33398198, 37945903	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	36750564	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38685053	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (18)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Colonic Neoplasms	Colonic Neoplasms	BEFREE	12736707		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25695204		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31612869, 31893510	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	21163515, 31596431	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	21163515, 31356921		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	21163515, 31356921		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	31596431	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	28350854	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	28350854	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	28289186	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16273224, 28350854		★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	31596431	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35945754	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16273224, 28350854		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	28350854	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12736707		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28350854	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	37813584	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CLDN24 6 shared pathwaysVirion - Hepatitis viruses, Cell adhesion molecules, Tight junction, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Hepatitis C Related via 6 shared pathways including Virion - Hepatitis viruses, Cell adhesion molecules. CLDN34 6 shared pathwaysVirion - Hepatitis viruses, Cell adhesion molecules, Tight junction, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Hepatitis C Related via 6 shared pathways including Virion - Hepatitis viruses, Cell adhesion molecules. CLDN16 6 shared pathwaysVirion - Hepatitis viruses, Cell adhesion molecules, Tight junction, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Hepatitis C Related via 6 shared pathways including Virion - Hepatitis viruses, Cell adhesion molecules. CLDN4 6 shared pathwaysVirion - Hepatitis viruses, Cell adhesion molecules, Tight junction, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Hepatitis C Related via 6 shared pathways including Virion - Hepatitis viruses, Cell adhesion molecules. CLDN3 6 shared pathwaysVirion - Hepatitis viruses, Cell adhesion molecules, Tight junction, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Hepatitis C Related via 6 shared pathways including Virion - Hepatitis viruses, Cell adhesion molecules.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CLDN24	0	[]	6	["Virion - Hepatitis viruses","Cell adhesion molecules","Tight junction","Leukocyte transendothelial migration","Pathogenic Escherichia coli infection","Hepatitis C"]	0	[]
CLDN34	0	[]	6	["Virion - Hepatitis viruses","Cell adhesion molecules","Tight junction","Leukocyte transendothelial migration","Pathogenic Escherichia coli infection","Hepatitis C"]	0	[]
CLDN16	0	[]	6	["Virion - Hepatitis viruses","Cell adhesion molecules","Tight junction","Leukocyte transendothelial migration","Pathogenic Escherichia coli infection","Hepatitis C"]	0	[]
CLDN4	0	[]	6	["Virion - Hepatitis viruses","Cell adhesion molecules","Tight junction","Leukocyte transendothelial migration","Pathogenic Escherichia coli infection","Hepatitis C"]	0	[]
CLDN3	0	[]	6	["Virion - Hepatitis viruses","Cell adhesion molecules","Tight junction","Leukocyte transendothelial migration","Pathogenic Escherichia coli infection","Hepatitis C"]	0	[]

Diseases Linked via Similar Genes

Polycystic ovary syndrome Linked via 2 of 5 related genesCLDN16, CLDN4 Jeune syndrome Linked via 1 of 5 related genesCLDN24 Stroke Linked via 1 of 5 related genesCLDN24 Magnesium metabolism disorder Linked via 1 of 5 related genesCLDN16 Gestational diabetes Linked via 1 of 5 related genesCLDN16

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Polycystic ovary syndrome	2	["CLDN16","CLDN4"]
Jeune syndrome	1	["CLDN24"]
Stroke	1	["CLDN24"]
Magnesium metabolism disorder	1	["CLDN16"]
Gestational diabetes	1	["CLDN16"]