CKAP5 (cytoskeleton associated protein 5)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9793
• Gene name: Cytoskeleton associated protein 5
• Gene symbol: CKAP5
• Synonyms (NCBI Gene): CHTOG, MSPS, TOG, TOGp, ch-TOG
• Chromosome: 11
• Chromosome location: 11p11.2
• Summary: This gene encodes a cytoskeleton-associated protein which belongs to the TOG/XMAP215 family. The N-terminal half of this protein contains a microtubule-binding domain and the C-terminal half contains a KXGS motif for binding tubulin dimers. This protein h

miRNA Show/Hide all (143)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006116	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	21799781
MIRT006116	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	21799781
MIRT006116	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	21799781
MIRT006116	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	21799781
MIRT006116	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	21799781
MIRT006116	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	21799781
MIRT020260	hsa-miR-130b-3p	Sequencing	20371350
MIRT006116	hsa-miR-155-5p	Proteomics	18668040
MIRT025470	hsa-miR-34a-5p	Proteomics	21566225
MIRT027176	hsa-miR-103a-3p	Sequencing	20371350
MIRT030873	hsa-miR-21-5p	Microarray	18591254
MIRT031322	hsa-miR-18a-5p	Sequencing	20371350
MIRT031832	hsa-miR-16-5p	Proteomics	18668040
MIRT046473	hsa-miR-15b-5p	CLASH	23622248
MIRT044934	hsa-miR-186-5p	CLASH	23622248
MIRT042131	hsa-miR-484	CLASH	23622248
MIRT894169	hsa-miR-1197	CLIP-seq
MIRT894170	hsa-miR-1227	CLIP-seq
MIRT894171	hsa-miR-1276	CLIP-seq
MIRT894172	hsa-miR-1286	CLIP-seq
MIRT894173	hsa-miR-151-3p	CLIP-seq
MIRT894174	hsa-miR-15a	CLIP-seq
MIRT894175	hsa-miR-15b	CLIP-seq
MIRT894176	hsa-miR-16	CLIP-seq
MIRT894177	hsa-miR-195	CLIP-seq
MIRT894178	hsa-miR-214	CLIP-seq
MIRT894179	hsa-miR-2278	CLIP-seq
MIRT894180	hsa-miR-3064-3p	CLIP-seq
MIRT894181	hsa-miR-3117-3p	CLIP-seq
MIRT894182	hsa-miR-3619-5p	CLIP-seq
MIRT894183	hsa-miR-3660	CLIP-seq
MIRT894184	hsa-miR-424	CLIP-seq
MIRT894185	hsa-miR-4263	CLIP-seq
MIRT894186	hsa-miR-4311	CLIP-seq
MIRT894187	hsa-miR-4463	CLIP-seq
MIRT894188	hsa-miR-4468	CLIP-seq
MIRT894189	hsa-miR-4496	CLIP-seq
MIRT894190	hsa-miR-4499	CLIP-seq
MIRT894191	hsa-miR-4526	CLIP-seq
MIRT894192	hsa-miR-4704-5p	CLIP-seq
MIRT894193	hsa-miR-4777-5p	CLIP-seq
MIRT894194	hsa-miR-486-3p	CLIP-seq
MIRT894195	hsa-miR-488	CLIP-seq
MIRT894196	hsa-miR-497	CLIP-seq
MIRT894197	hsa-miR-518d-5p	CLIP-seq
MIRT894198	hsa-miR-519b-5p	CLIP-seq
MIRT894199	hsa-miR-519c-5p	CLIP-seq
MIRT894200	hsa-miR-520c-5p	CLIP-seq
MIRT894201	hsa-miR-520d-5p	CLIP-seq
MIRT894202	hsa-miR-524-5p	CLIP-seq
MIRT894203	hsa-miR-526a	CLIP-seq
MIRT894204	hsa-miR-576-5p	CLIP-seq
MIRT894205	hsa-miR-583	CLIP-seq
MIRT894206	hsa-miR-590-3p	CLIP-seq
MIRT894207	hsa-miR-761	CLIP-seq
MIRT894172	hsa-miR-1286	CLIP-seq
MIRT894174	hsa-miR-15a	CLIP-seq
MIRT894175	hsa-miR-15b	CLIP-seq
MIRT894176	hsa-miR-16	CLIP-seq
MIRT894177	hsa-miR-195	CLIP-seq
MIRT894178	hsa-miR-214	CLIP-seq
MIRT894179	hsa-miR-2278	CLIP-seq
MIRT894182	hsa-miR-3619-5p	CLIP-seq
MIRT894183	hsa-miR-3660	CLIP-seq
MIRT894184	hsa-miR-424	CLIP-seq
MIRT894188	hsa-miR-4468	CLIP-seq
MIRT894191	hsa-miR-4526	CLIP-seq
MIRT894192	hsa-miR-4704-5p	CLIP-seq
MIRT894193	hsa-miR-4777-5p	CLIP-seq
MIRT894194	hsa-miR-486-3p	CLIP-seq
MIRT894196	hsa-miR-497	CLIP-seq
MIRT894197	hsa-miR-518d-5p	CLIP-seq
MIRT894198	hsa-miR-519b-5p	CLIP-seq
MIRT894199	hsa-miR-519c-5p	CLIP-seq
MIRT894200	hsa-miR-520c-5p	CLIP-seq
MIRT894203	hsa-miR-526a	CLIP-seq
MIRT894207	hsa-miR-761	CLIP-seq
MIRT894170	hsa-miR-1227	CLIP-seq
MIRT894172	hsa-miR-1286	CLIP-seq
MIRT894174	hsa-miR-15a	CLIP-seq
MIRT894175	hsa-miR-15b	CLIP-seq
MIRT894176	hsa-miR-16	CLIP-seq
MIRT894177	hsa-miR-195	CLIP-seq
MIRT894178	hsa-miR-214	CLIP-seq
MIRT894179	hsa-miR-2278	CLIP-seq
MIRT1965133	hsa-miR-2681	CLIP-seq
MIRT894180	hsa-miR-3064-3p	CLIP-seq
MIRT894182	hsa-miR-3619-5p	CLIP-seq
MIRT894183	hsa-miR-3660	CLIP-seq
MIRT894184	hsa-miR-424	CLIP-seq
MIRT894191	hsa-miR-4526	CLIP-seq
MIRT1965134	hsa-miR-4659a-5p	CLIP-seq
MIRT1965135	hsa-miR-4659b-5p	CLIP-seq
MIRT894192	hsa-miR-4704-5p	CLIP-seq
MIRT894193	hsa-miR-4777-5p	CLIP-seq
MIRT1965136	hsa-miR-485-3p	CLIP-seq
MIRT894196	hsa-miR-497	CLIP-seq
MIRT894197	hsa-miR-518d-5p	CLIP-seq
MIRT894198	hsa-miR-519b-5p	CLIP-seq
MIRT894199	hsa-miR-519c-5p	CLIP-seq
MIRT894200	hsa-miR-520c-5p	CLIP-seq
MIRT894203	hsa-miR-526a	CLIP-seq
MIRT1965137	hsa-miR-586	CLIP-seq
MIRT894207	hsa-miR-761	CLIP-seq
MIRT1965136	hsa-miR-485-3p	CLIP-seq
MIRT894183	hsa-miR-3660	CLIP-seq
MIRT894191	hsa-miR-4526	CLIP-seq
MIRT2503887	hsa-miR-1224-5p	CLIP-seq
MIRT894170	hsa-miR-1227	CLIP-seq
MIRT2503888	hsa-miR-1245b-5p	CLIP-seq
MIRT894171	hsa-miR-1276	CLIP-seq
MIRT894180	hsa-miR-3064-3p	CLIP-seq
MIRT894181	hsa-miR-3117-3p	CLIP-seq
MIRT2503889	hsa-miR-3142	CLIP-seq
MIRT2503890	hsa-miR-3149	CLIP-seq
MIRT2503891	hsa-miR-370	CLIP-seq
MIRT894185	hsa-miR-4263	CLIP-seq
MIRT2503892	hsa-miR-4304	CLIP-seq
MIRT894186	hsa-miR-4311	CLIP-seq
MIRT894189	hsa-miR-4496	CLIP-seq
MIRT2503893	hsa-miR-4649-3p	CLIP-seq
MIRT2503894	hsa-miR-4663	CLIP-seq
MIRT894192	hsa-miR-4704-5p	CLIP-seq
MIRT2503895	hsa-miR-4751	CLIP-seq
MIRT2503896	hsa-miR-4789-5p	CLIP-seq
MIRT894195	hsa-miR-488	CLIP-seq
MIRT2503897	hsa-miR-568	CLIP-seq
MIRT894204	hsa-miR-576-5p	CLIP-seq
MIRT894205	hsa-miR-583	CLIP-seq
MIRT2503887	hsa-miR-1224-5p	CLIP-seq
MIRT894170	hsa-miR-1227	CLIP-seq
MIRT2503888	hsa-miR-1245b-5p	CLIP-seq
MIRT894180	hsa-miR-3064-3p	CLIP-seq
MIRT2503889	hsa-miR-3142	CLIP-seq
MIRT2503890	hsa-miR-3149	CLIP-seq
MIRT2503891	hsa-miR-370	CLIP-seq
MIRT2503892	hsa-miR-4304	CLIP-seq
MIRT2503893	hsa-miR-4649-3p	CLIP-seq
MIRT2503894	hsa-miR-4663	CLIP-seq
MIRT894192	hsa-miR-4704-5p	CLIP-seq
MIRT2503895	hsa-miR-4751	CLIP-seq
MIRT2503896	hsa-miR-4789-5p	CLIP-seq
MIRT2503897	hsa-miR-568	CLIP-seq

Gene ontology (GO) Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000776	Component	Kinetochore	IDA	25596274
GO:0000776	Component	Kinetochore	IEA
GO:0000922	Component	Spindle pole	IBA
GO:0000922	Component	Spindle pole	IDA	21646404
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	11903063, 14603251, 15703215, 17474147, 20360068, 21297582, 26496610, 33961781
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	15703215
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	14718566, 21399614, 21646404
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005929	Component	Cilium	IDA
GO:0007019	Process	Microtubule depolymerization	TAS	26323690
GO:0007051	Process	Spindle organization	IEA
GO:0007051	Process	Spindle organization	IMP	14718566
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0007098	Process	Centrosome cycle	IMP	14718566
GO:0007098	Process	Centrosome cycle	IMP	14718566
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IDA	10770946
GO:0015630	Component	Microtubule cytoskeleton	ISS	15703215
GO:0015631	Function	Tubulin binding	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0030951	Process	Establishment or maintenance of microtubule cytoskeleton polarity	IBA
GO:0030951	Process	Establishment or maintenance of microtubule cytoskeleton polarity	IEA
GO:0030951	Process	Establishment or maintenance of microtubule cytoskeleton polarity	IMP	14718566
GO:0032991	Component	Protein-containing complex	IDA	18468998
GO:0035371	Component	Microtubule plus-end	IBA
GO:0035371	Component	Microtubule plus-end	IDA	21646404
GO:0036064	Component	Ciliary basal body	IDA
GO:0043021	Function	Ribonucleoprotein complex binding	IDA	15703215
GO:0043933	Process	Protein-containing complex organization	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0046785	Process	Microtubule polymerization	IBA
GO:0046785	Process	Microtubule polymerization	IEA
GO:0046785	Process	Microtubule polymerization	TAS	26323690
GO:0050658	Process	RNA transport	ISS	15703215
GO:0051010	Function	Microtubule plus-end binding	IEA
GO:0051298	Process	Centrosome duplication	IBA
GO:0051301	Process	Cell division	IEA
GO:0061863	Function	Microtubule plus end polymerase	IBA
GO:0061863	Function	Microtubule plus end polymerase	IEA
GO:0072686	Component	Mitotic spindle	IDA
GO:0090063	Process	Positive regulation of microtubule nucleation	IDA	26414402

Other IDs

• MIM: 611142
• HGNC: 28959
• e!Ensembl: ENSG00000175216

Protein

• UniProt ID: Q14008
• Protein name: Cytoskeleton-associated protein 5 (Colonic and hepatic tumor overexpressed gene protein) (Ch-TOG)
• Protein function: Binds to the plus end of microtubules and regulates microtubule dynamics and microtubule organization. Acts as a processive microtubule polymerase. Promotes cytoplasmic microtubule nucleation and elongation. Plays a major role in organizing spin
• PDB: 4QMI , 4QMJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02985	HEAT	440 → 470	HEAT repeat	Repeat
  PF12348	CLASP_N	856 → 1075	CLASP N terminal	Family
  PF12348	CLASP_N	1231 → 1425	CLASP N terminal	Family

• Tissue specificity: TISSUE SPECIFICITY: Overexpressed in hepatomas and colonic tumors. Also expressed in skeletal muscle, brain, heart, placenta, lung, liver, kidney and pancreas. Expression is elevated in the brain; highly expressed in the Purkinje cell bodies of the cerebe
• Sequence:

  MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDS
  NAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIE
  KGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAV
  RDEAKLIAVEIYRWIRDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEA
  KLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEAL
  ESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAG
  HVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFI
  ARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLA
  DVDKLKLDKIKECSEKVELIHGKKAGLAADKKEFKPLPGRTAASGAAGDKDTKDISAPKP
  GPLKKAPAAKAGGPPKKGKPAAPGGAGNTGTKNKKGLETKEIVEPELSIEVCEEKASAVL
  PPTCIQLLDSSNWKERLACMEEFQKAVELMDRTEMPCQALVRMLAKKPGWKETNFQVMQM
  KLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVV
  SMAFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPAVRTAAITLLG
  VMYLYVGPSLRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHSTSGTDEGEDGDE
  PDDGSNDVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPNIGE
  LPTALKGRLNDSNKILVQQTLNILQQLAVAMGPNIKQHVKNLGIPIITVLGDSKNNVRAA
  ALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRSTPTDLILCV
  PHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKATGKLKPTSKDQVLAMLEKAKVNM
  PAKPAPPTKATSKPMGGSAPAKFQPASAPAEDCISSSTEPKPDPKKAKAPGLSSKAKSAQ
  GKKMPSKTSLKEDEDKSGPIFIVVPNGKEQRMKDEKGLKVLKWNFTTPRDEYIEQLKTQM
  SSCVAKWLQDEMFHSDFQHHNKALAVMVDHLESEKEGVIGCLDLILKWLTLRFFDTNTSV
  LMKALEYLKLLFTLLSEEEYHLTENEASSFIPYLVVKVGEPKDVIRKDVRAILNRMCLVY
  PASKMFPFIMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPGKALKEIAVHIGDRDN
  AVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIKRSAKRPSAAPIKQVEEKPQ
  RAQNISSNANMLRKGPAEDMSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRC
  EMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQA
  LTQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYNTHMADEKLEKDEIIKLYSCIIGN
  MISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSD
  QTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFM
  KVFPKEKLKQCKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCRMMKH
  SMDQTGSKSDKETEKGASRIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKY
  SDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVS
  SIGNTNGEEVGPSVYLERLKILRQRCGLDNTKQDDRPPLTSLLSKPAVPTVASSTDMLHS
  KLSQLRESREQHQHSDLDSNQTHSSGTVTSSSSTANIDDLKKRLERIKSSRK

• Sequence length: 2032

Pathways

Reactome Pathway

Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal

Separation of Sister Chromatids

Resolution of Sister Chromatid Cohesion

Regulation of PLK1 Activity at G2/M Transition

Loss of Nlp from mitotic centrosomes

Recruitment of mitotic centrosome proteins and complexes

Loss of proteins required for interphase microtubule organization from the centrosome

Recruitment of NuMA to mitotic centrosomes

Anchoring of the basal body to the plasma membrane

RHO GTPases Activate Formins

Mitotic Prometaphase

AURKA Activation by TPX2

EML4 and NUDC in mitotic spindle formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (14)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	30820047, 39998322	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEUPLOIDY	—	CTD	24976383	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHROMOSOMAL INSTABILITY	—	CTD	24976383	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	30820047	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	35771237	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	35285134	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (9)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33540684	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10766876	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31058365	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30305138		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	14749730	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26497677		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	22147262	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28063167, 8832653		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28101582, 28588715		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CLASP1 13 shared pathwaysAmplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation, Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane +1 more Related via 13 shared pathways including Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids. NDE1 13 shared pathwaysAmplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation, Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane +1 more Related via 13 shared pathways including Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids. AURKA 2 shared diseasesAneuploidy, Chromosomal instability 2 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, AURKA Activation by TPX2 2 shared evidence sourcesCTD (Aneuploidy), CTD (Chromosomal instability) Related via 2 shared diseases including Aneuploidy, Chromosomal instability — evidence mostly CTD. MAPRE1 1 shared diseasePolycystic ovary syndrome 13 shared pathwaysAmplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation, Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane +1 more 1 shared evidence sourceGWAS catalog (Polycystic ovary syndrome) Related via 13 shared pathways including Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids — evidence mostly GWAS catalog. PAFAH1B1 13 shared pathwaysAmplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation, Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane +1 more Related via 13 shared pathways including Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CLASP1	0	[]	13	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation","Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane"]	0	[]
NDE1	0	[]	13	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation","Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane"]	0	[]
AURKA	2	["Aneuploidy","Chromosomal instability"]	2	["Regulation of PLK1 Activity at G2\/M Transition","AURKA Activation by TPX2"]	2	["CTD (Aneuploidy)","CTD (Chromosomal instability)"]
MAPRE1	1	["Polycystic ovary syndrome"]	13	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation","Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane"]	1	["GWAS catalog (Polycystic ovary syndrome)"]
PAFAH1B1	0	[]	13	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation","Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane"]	0	[]

Diseases Linked via Similar Genes

Intellectual developmental disorder Linked via 3 of 5 related genesNDE1, AURKA, PAFAH1B1 Lissencephaly Linked via 2 of 5 related genesNDE1, PAFAH1B1 Macrogyria Linked via 2 of 5 related genesNDE1, PAFAH1B1 Schizophrenia Linked via 2 of 5 related genesNDE1, PAFAH1B1 Bipolar disorder Linked via 1 of 5 related genesCLASP1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Intellectual developmental disorder	3	["NDE1","AURKA","PAFAH1B1"]
Lissencephaly	2	["NDE1","PAFAH1B1"]
Macrogyria	2	["NDE1","PAFAH1B1"]
Schizophrenia	2	["NDE1","PAFAH1B1"]
Bipolar disorder	1	["CLASP1"]