Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	8534
Gene name	Carbohydrate sulfotransferase 1
Gene symbol	CHST1
Synonyms (NCBI Gene)	C6STGST-1KS6STKSGal6STKSST
Chromosome	11
Chromosome location	11p11.2
Summary	This locus encodes a member of the keratin sulfotransferase family of proteins. The encoded enzyme catalyzes the sulfation of the proteoglycan keratin. [provided by RefSeq, Aug 2011]

41 Show/Hide all (41)

miRTarBase ID	miRNA	Experiments
MIRT892239	hsa-miR-4704-3p	CLIP-seq
MIRT1964400	hsa-miR-1207-5p	CLIP-seq
MIRT1964401	hsa-miR-1324	CLIP-seq
MIRT1964402	hsa-miR-197	CLIP-seq
MIRT1964403	hsa-miR-3180	CLIP-seq
MIRT1964404	hsa-miR-3180-3p	CLIP-seq
MIRT1964405	hsa-miR-3196	CLIP-seq
MIRT1964406	hsa-miR-4459	CLIP-seq
MIRT1964407	hsa-miR-4488	CLIP-seq
MIRT1964408	hsa-miR-4695-5p	CLIP-seq
MIRT1964409	hsa-miR-4697-5p	CLIP-seq
MIRT1964410	hsa-miR-4763-3p	CLIP-seq
MIRT1964411	hsa-miR-4790-3p	CLIP-seq
MIRT1964412	hsa-miR-940	CLIP-seq
MIRT2200560	hsa-miR-1247	CLIP-seq
MIRT2200561	hsa-miR-1271	CLIP-seq
MIRT2200562	hsa-miR-1281	CLIP-seq
MIRT2200563	hsa-miR-130a	CLIP-seq
MIRT2200564	hsa-miR-130b	CLIP-seq
MIRT1964401	hsa-miR-1324	CLIP-seq
MIRT2200565	hsa-miR-182	CLIP-seq
MIRT2200566	hsa-miR-19a	CLIP-seq
MIRT2200567	hsa-miR-19b	CLIP-seq
MIRT2200568	hsa-miR-301a	CLIP-seq
MIRT2200569	hsa-miR-301b	CLIP-seq
MIRT1964403	hsa-miR-3180	CLIP-seq
MIRT1964404	hsa-miR-3180-3p	CLIP-seq
MIRT1964405	hsa-miR-3196	CLIP-seq
MIRT2200570	hsa-miR-3666	CLIP-seq
MIRT2200571	hsa-miR-3919	CLIP-seq
MIRT2200572	hsa-miR-3942-3p	CLIP-seq
MIRT2200573	hsa-miR-4295	CLIP-seq
MIRT1964407	hsa-miR-4488	CLIP-seq
MIRT2200574	hsa-miR-454	CLIP-seq
MIRT2200575	hsa-miR-4671-3p	CLIP-seq
MIRT1964409	hsa-miR-4697-5p	CLIP-seq
MIRT892239	hsa-miR-4704-3p	CLIP-seq
MIRT2200576	hsa-miR-4756-3p	CLIP-seq
MIRT1964411	hsa-miR-4790-3p	CLIP-seq
MIRT2200577	hsa-miR-513a-3p	CLIP-seq
MIRT2200578	hsa-miR-96	CLIP-seq

28 Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001517	Function	N-acetylglucosamine 6-O-sulfotransferase activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005794	Component	Golgi apparatus	IEA
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0005976	Process	Polysaccharide metabolic process	TAS	9405439
GO:0006012	Process	Galactose metabolic process	IDA	10330415
GO:0006044	Process	N-acetylglucosamine metabolic process	IBA
GO:0006790	Process	Sulfur compound metabolic process	IBA
GO:0006790	Process	Sulfur compound metabolic process	IDA	10330415
GO:0006790	Process	Sulfur compound metabolic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008146	Function	Sulfotransferase activity	IDA	10330415
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0008146	Function	Sulfotransferase activity	TAS	9405439
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9405439
GO:0016020	Component	Membrane	TAS	9639683
GO:0016740	Function	Transferase activity	IEA
GO:0018146	Process	Keratan sulfate proteoglycan biosynthetic process	IDA	17690104
GO:0018146	Process	Keratan sulfate proteoglycan biosynthetic process	TAS
GO:0042339	Process	Keratan sulfate proteoglycan metabolic process	IBA
GO:0042339	Process	Keratan sulfate proteoglycan metabolic process	IDA	9405439
GO:0045130	Function	Keratan sulfotransferase activity	IBA
GO:0045130	Function	Keratan sulfotransferase activity	IDA	9405439, 17690104
GO:0045130	Function	Keratan sulfotransferase activity	IEA
GO:0045130	Function	Keratan sulfotransferase activity	TAS

MIM	HGNC	e!Ensembl
603797	1969	ENSG00000175264

O43916

Protein name

Carbohydrate sulfotransferase 1 (Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1) (GST-1) (Keratan sulfate Gal-6 sulfotransferase) (KS6ST) (KSGal6ST) (KSST) (EC 2.8.2.21)

Protein function

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of internal galactose (Gal) residues of keratan. Cooperates with B4GALT4 and B3GNT7 glycosyltransferases an

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00685	Sulfotransfer_1	60 → 384	Sulfotransferase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed at low level. Expressed in brain and skeletal muscle. Expressed by high endothelial cells (HEVs) and leukocytes. {ECO:0000269|PubMed:11310842, ECO:0000269|PubMed:9405439}.

Sequence

MQCSWKAVLLLALASIAIQYTAIRTFTAKSFHTCPGLAEAGLAERLCEESPTFAYNLSRK
THILILATTRSGSSFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGAS
RDLLRSLYDCDLYFLENYIKPPPVNHTTDRIFRRGASRVLCSRPVCDPPGPADLVLEEGD
CVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLRALVEDPRLNLKVIQLVRDPRGIL
ASRSETFRDTYRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV
RYEDLARNPMKKTEEIYGFLGIPLDSHVARWIQNNTRGDPTLGKHKYGTVRNSAATAEKW
RFRLSYDIVAFAQNACQQVLAQLGYKIAASEEELKNPSVSLVEERDFRPFS

Sequence length

411

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glycosaminoglycan biosynthesis - keratan sulfate	Keratan sulfate biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (11)
ALZHEIMER DISEASE	—	GWAS catalog	31055733	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	32747698	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	28270201	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	33495597	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	39349682	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	39358599	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	39358599	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	34593835	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	34737425	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (8)
Anorexia Nervosa	Anorexia nervosa	Pubtator	35013117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	9639683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32605588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	7781744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35013117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	LHGDN	18698629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15834859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35225482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CHST1 (carbohydrate sulfotransferase 1)

Bookmark This Gene