CETN2 (centrin 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1069
• Gene name: Centrin 2
• Gene symbol: CETN2
• Synonyms (NCBI Gene): CALT, CEN2
• Chromosome: X
• Chromosome location: Xq28
• Summary: Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in

miRNA Show/Hide all (52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050854	hsa-miR-17-5p	CLASH	23622248
MIRT887316	hsa-miR-1207-5p	CLIP-seq
MIRT887317	hsa-miR-1228	CLIP-seq
MIRT887318	hsa-miR-147	CLIP-seq
MIRT887319	hsa-miR-2052	CLIP-seq
MIRT887320	hsa-miR-3140-3p	CLIP-seq
MIRT887321	hsa-miR-3163	CLIP-seq
MIRT887322	hsa-miR-340	CLIP-seq
MIRT887323	hsa-miR-377	CLIP-seq
MIRT887324	hsa-miR-4269	CLIP-seq
MIRT887325	hsa-miR-4311	CLIP-seq
MIRT887326	hsa-miR-4736	CLIP-seq
MIRT887327	hsa-miR-4763-3p	CLIP-seq
MIRT887328	hsa-miR-520d-5p	CLIP-seq
MIRT887329	hsa-miR-524-5p	CLIP-seq
MIRT887330	hsa-miR-580	CLIP-seq
MIRT887331	hsa-miR-581	CLIP-seq
MIRT887332	hsa-miR-629	CLIP-seq
MIRT1963187	hsa-miR-106a	CLIP-seq
MIRT1963188	hsa-miR-106b	CLIP-seq
MIRT887316	hsa-miR-1207-5p	CLIP-seq
MIRT1963189	hsa-miR-17	CLIP-seq
MIRT1963190	hsa-miR-20a	CLIP-seq
MIRT1963191	hsa-miR-20b	CLIP-seq
MIRT1963192	hsa-miR-330-3p	CLIP-seq
MIRT1963193	hsa-miR-3609	CLIP-seq
MIRT1963194	hsa-miR-3665	CLIP-seq
MIRT1963195	hsa-miR-3907	CLIP-seq
MIRT1963196	hsa-miR-3974	CLIP-seq
MIRT1963197	hsa-miR-4698	CLIP-seq
MIRT887326	hsa-miR-4736	CLIP-seq
MIRT1963198	hsa-miR-4761-5p	CLIP-seq
MIRT887327	hsa-miR-4763-3p	CLIP-seq
MIRT1963199	hsa-miR-4796-3p	CLIP-seq
MIRT1963200	hsa-miR-519d	CLIP-seq
MIRT1963201	hsa-miR-548ah	CLIP-seq
MIRT1963202	hsa-miR-764	CLIP-seq
MIRT1963203	hsa-miR-93	CLIP-seq
MIRT887316	hsa-miR-1207-5p	CLIP-seq
MIRT887317	hsa-miR-1228	CLIP-seq
MIRT2199579	hsa-miR-148a	CLIP-seq
MIRT2199580	hsa-miR-148b	CLIP-seq
MIRT2199581	hsa-miR-152	CLIP-seq
MIRT1963192	hsa-miR-330-3p	CLIP-seq
MIRT1963194	hsa-miR-3665	CLIP-seq
MIRT1963195	hsa-miR-3907	CLIP-seq
MIRT887324	hsa-miR-4269	CLIP-seq
MIRT1963197	hsa-miR-4698	CLIP-seq
MIRT887326	hsa-miR-4736	CLIP-seq
MIRT887327	hsa-miR-4763-3p	CLIP-seq
MIRT1963202	hsa-miR-764	CLIP-seq
MIRT2199582	hsa-miR-889	CLIP-seq

Gene ontology (GO) Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000278	Process	Mitotic cell cycle	NAS	8248209
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	NAS	8248209
GO:0005515	Function	Protein binding	IPI	16760425, 16956364, 19615732, 21962512, 23591820, 25416956, 25959826, 26638075, 28514442, 29892012, 31515488, 32296183, 32814053, 33961781, 34591612, 34591642, 35271311, 35709258
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005643	Component	Nuclear pore	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	16760425, 21399614, 37934472
GO:0005813	Component	Centrosome	IEA
GO:0005813	Component	Centrosome	NAS	8248209
GO:0005814	Component	Centriole	IBA
GO:0005814	Component	Centriole	IDA	12176356, 22349705, 23591820, 24421332, 32110738, 37934472
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006289	Process	Nucleotide-excision repair	IBA
GO:0006289	Process	Nucleotide-excision repair	IDA	15964821
GO:0006974	Process	DNA damage response	IEA
GO:0007099	Process	Centriole replication	IBA
GO:0007099	Process	Centriole replication	IMP	12176356
GO:0007283	Process	Spermatogenesis	IEA
GO:0008017	Function	Microtubule binding	IEA
GO:0015031	Process	Protein transport	IEA
GO:0031683	Function	G-protein beta/gamma-subunit complex binding	IEA
GO:0032391	Component	Photoreceptor connecting cilium	IEA
GO:0032465	Process	Regulation of cytokinesis	IMP	16760425
GO:0032795	Function	Heterotrimeric G-protein binding	IEA
GO:0036064	Component	Ciliary basal body	IEA
GO:0044615	Component	Nuclear pore nuclear basket	IDA	23591820
GO:0045177	Component	Apical part of cell	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051028	Process	MRNA transport	IEA
GO:0051301	Process	Cell division	IEA
GO:0070390	Component	Transcription export complex 2	IDA	23591820
GO:0071942	Component	XPC complex	IDA	11279143
GO:0097386	Component	Glial cell projection	IEA
GO:0097729	Component	9+2 motile cilium	IEA

Other IDs

• MIM: 300006
• HGNC: 1867
• e!Ensembl: ENSG00000147400

Protein

• UniProt ID: P41208
• Protein name: Centrin-2 (Caltractin isoform 1)
• Protein function: Plays a fundamental role in microtubule organizing center structure and function. Required for centriole duplication and correct spindle formation. Has a role in regulating cytokinesis and genome stability via cooperation with CALM1 and CCP110.;
• PDB: 1M39 , 1ZMZ , 2A4J , 2GGM , 2K2I , 2OBH , 8EBS , 8EBT , 8EBV , 8EBW , 8EBX , 8J07
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13499	EF-hand_7	103 → 167	EF-hand domain pair	Domain
  PF13499	EF-hand_7	30 → 94	EF-hand domain pair	Domain

• Sequence:

  MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRAL
  GFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGK
  ISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY

• Sequence length: 172

Pathways

KEGG Pathway	Reactome Pathway
Nucleotide excision repair	Regulation of PLK1 Activity at G2/M Transition
	SUMOylation of DNA damage response and repair proteins
	Loss of Nlp from mitotic centrosomes
	Recruitment of mitotic centrosome proteins and complexes
	Loss of proteins required for interphase microtubule organization from the centrosome
	Recruitment of NuMA to mitotic centrosomes
	Anchoring of the basal body to the plasma membrane
	DNA Damage Recognition in GG-NER
	Formation of Incision Complex in GG-NER
	AURKA Activation by TPX2

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Lung cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (20)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	Pubtator	31952466	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	23047184		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	25299107		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20388771	Associate	★☆☆☆☆ Found in Text Mining only
Cacosmia	Cacosmia	BEFREE	24790208		★☆☆☆☆ Found in Text Mining only
Chondrodysplasia Punctata	Chondrodysplasia	Pubtator	8828037	Associate	★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	24790208		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23577133, 28077117	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35441719	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	24790208		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	24790208		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23047184		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23522059	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23577133		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31952466	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	9665797		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28077117		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	LHGDN	12890685		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum Complementation Group C	Xeroderma pigmentosum	Pubtator	11279143, 16627479	Associate	★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	15964821		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SDCCAG8 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes. CEP250 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes. HAUS1 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes. NEDD1 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes. CEP164 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SDCCAG8	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]
CEP250	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]
HAUS1	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]
NEDD1	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]
CEP164	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]

Diseases Linked via Similar Genes

Retinitis pigmentosa Linked via 3 of 5 related genesSDCCAG8, CEP250, CEP164 Ciliopathy Linked via 2 of 5 related genesSDCCAG8, CEP164 Metabolic syndrome Linked via 2 of 5 related genesSDCCAG8, CEP164 Nephronophthisis Linked via 2 of 5 related genesSDCCAG8, CEP164 Senior-loken syndrome Linked via 2 of 5 related genesSDCCAG8, CEP164

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Retinitis pigmentosa	3	["SDCCAG8","CEP250","CEP164"]
Ciliopathy	2	["SDCCAG8","CEP164"]
Metabolic syndrome	2	["SDCCAG8","CEP164"]
Nephronophthisis	2	["SDCCAG8","CEP164"]
Senior-loken syndrome	2	["SDCCAG8","CEP164"]