CEP70 (centrosomal protein 70)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 80321
• Gene name: Centrosomal protein 70
• Gene symbol: CEP70
• Synonyms (NCBI Gene): BITE
• Chromosome: 3
• Chromosome location: 3q22.3

miRNA Show/Hide all (113)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020024	hsa-miR-375	Microarray	20215506
MIRT639180	hsa-miR-1272	HITS-CLIP	23824327
MIRT639179	hsa-miR-1470	HITS-CLIP	23824327
MIRT639178	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT639177	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT639176	hsa-miR-3682-3p	HITS-CLIP	23824327
MIRT639175	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT639174	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT639173	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT639172	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT639180	hsa-miR-1272	HITS-CLIP	23824327
MIRT639179	hsa-miR-1470	HITS-CLIP	23824327
MIRT639178	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT639177	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT639176	hsa-miR-3682-3p	HITS-CLIP	23824327
MIRT639175	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT639174	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT639173	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT639172	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT886422	hsa-miR-106a	CLIP-seq
MIRT886423	hsa-miR-106b	CLIP-seq
MIRT886424	hsa-miR-17	CLIP-seq
MIRT886425	hsa-miR-20a	CLIP-seq
MIRT886426	hsa-miR-20b	CLIP-seq
MIRT886427	hsa-miR-3163	CLIP-seq
MIRT886428	hsa-miR-3179	CLIP-seq
MIRT886429	hsa-miR-340	CLIP-seq
MIRT886430	hsa-miR-4509	CLIP-seq
MIRT886431	hsa-miR-4724-3p	CLIP-seq
MIRT886432	hsa-miR-4744	CLIP-seq
MIRT886433	hsa-miR-499-3p	CLIP-seq
MIRT886434	hsa-miR-499a-3p	CLIP-seq
MIRT886435	hsa-miR-519a	CLIP-seq
MIRT886436	hsa-miR-519b-3p	CLIP-seq
MIRT886437	hsa-miR-519c-3p	CLIP-seq
MIRT886438	hsa-miR-519d	CLIP-seq
MIRT886439	hsa-miR-548t	CLIP-seq
MIRT886440	hsa-miR-561	CLIP-seq
MIRT886441	hsa-miR-93	CLIP-seq
MIRT1962895	hsa-miR-1976	CLIP-seq
MIRT1962896	hsa-miR-370	CLIP-seq
MIRT1962897	hsa-miR-4659a-3p	CLIP-seq
MIRT1962898	hsa-miR-4659b-3p	CLIP-seq
MIRT1962899	hsa-miR-4691-5p	CLIP-seq
MIRT2199230	hsa-miR-4503	CLIP-seq
MIRT2199231	hsa-miR-513a-3p	CLIP-seq
MIRT2199232	hsa-miR-590-3p	CLIP-seq
MIRT2502009	hsa-miR-1202	CLIP-seq
MIRT2502010	hsa-miR-1227	CLIP-seq
MIRT2502011	hsa-miR-1233	CLIP-seq
MIRT2502012	hsa-miR-1256	CLIP-seq
MIRT2502013	hsa-miR-129-3p	CLIP-seq
MIRT2502014	hsa-miR-1303	CLIP-seq
MIRT2502015	hsa-miR-193a-3p	CLIP-seq
MIRT2502016	hsa-miR-193b	CLIP-seq
MIRT2502017	hsa-miR-2278	CLIP-seq
MIRT2502018	hsa-miR-302f	CLIP-seq
MIRT2502019	hsa-miR-3126-5p	CLIP-seq
MIRT886428	hsa-miR-3179	CLIP-seq
MIRT2502020	hsa-miR-362-5p	CLIP-seq
MIRT2502021	hsa-miR-3646	CLIP-seq
MIRT2502022	hsa-miR-3650	CLIP-seq
MIRT2502023	hsa-miR-3685	CLIP-seq
MIRT2502024	hsa-miR-3972	CLIP-seq
MIRT2502025	hsa-miR-4419a	CLIP-seq
MIRT2502026	hsa-miR-4474-3p	CLIP-seq
MIRT2199230	hsa-miR-4503	CLIP-seq
MIRT2502027	hsa-miR-4510	CLIP-seq
MIRT2502028	hsa-miR-455-5p	CLIP-seq
MIRT2502029	hsa-miR-4642	CLIP-seq
MIRT2502030	hsa-miR-4719	CLIP-seq
MIRT2502031	hsa-miR-4755-3p	CLIP-seq
MIRT2502032	hsa-miR-4768-3p	CLIP-seq
MIRT2502033	hsa-miR-4794	CLIP-seq
MIRT2502034	hsa-miR-500a	CLIP-seq
MIRT2502035	hsa-miR-500b	CLIP-seq
MIRT2502036	hsa-miR-502-5p	CLIP-seq
MIRT2199231	hsa-miR-513a-3p	CLIP-seq
MIRT2502037	hsa-miR-516a-3p	CLIP-seq
MIRT2199232	hsa-miR-590-3p	CLIP-seq
MIRT2502038	hsa-miR-644	CLIP-seq
MIRT2502039	hsa-miR-665	CLIP-seq
MIRT2502040	hsa-miR-892b	CLIP-seq
MIRT2502009	hsa-miR-1202	CLIP-seq
MIRT2502010	hsa-miR-1227	CLIP-seq
MIRT2502011	hsa-miR-1233	CLIP-seq
MIRT2502012	hsa-miR-1256	CLIP-seq
MIRT2502013	hsa-miR-129-3p	CLIP-seq
MIRT2502014	hsa-miR-1303	CLIP-seq
MIRT2502015	hsa-miR-193a-3p	CLIP-seq
MIRT2502016	hsa-miR-193b	CLIP-seq
MIRT2502017	hsa-miR-2278	CLIP-seq
MIRT2502019	hsa-miR-3126-5p	CLIP-seq
MIRT2502020	hsa-miR-362-5p	CLIP-seq
MIRT2502023	hsa-miR-3685	CLIP-seq
MIRT2502024	hsa-miR-3972	CLIP-seq
MIRT2502025	hsa-miR-4419a	CLIP-seq
MIRT2199230	hsa-miR-4503	CLIP-seq
MIRT2502027	hsa-miR-4510	CLIP-seq
MIRT2502028	hsa-miR-455-5p	CLIP-seq
MIRT2502029	hsa-miR-4642	CLIP-seq
MIRT2502030	hsa-miR-4719	CLIP-seq
MIRT2502031	hsa-miR-4755-3p	CLIP-seq
MIRT2502032	hsa-miR-4768-3p	CLIP-seq
MIRT2502033	hsa-miR-4794	CLIP-seq
MIRT2502034	hsa-miR-500a	CLIP-seq
MIRT2502035	hsa-miR-500b	CLIP-seq
MIRT2502036	hsa-miR-502-5p	CLIP-seq
MIRT2199231	hsa-miR-513a-3p	CLIP-seq
MIRT2502037	hsa-miR-516a-3p	CLIP-seq
MIRT2199232	hsa-miR-590-3p	CLIP-seq
MIRT2502039	hsa-miR-665	CLIP-seq
MIRT2502040	hsa-miR-892b	CLIP-seq

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 16713569, 19060904, 21900206, 23455924, 25416956, 25910212, 26871637, 27107012, 29892012, 31515488, 32296183, 32814053, 35914814
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005813	Component	Centrosome	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 27107012
GO:0043015	Function	Gamma-tubulin binding	IEA
GO:0060271	Process	Cilium assembly	IBA
GO:0060271	Process	Cilium assembly	IEA
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IEA

Other IDs

• MIM: 614310
• HGNC: 29972
• e!Ensembl: ENSG00000114107

Protein

• UniProt ID: Q8NHQ1
• Protein name: Centrosomal protein of 70 kDa (Cep70) (p10-binding protein)
• Protein function: Plays a role in the organization of both preexisting and nascent microtubules in interphase cells. During mitosis, required for the organization and orientation of the mitotic spindle.
• Sequence:

  MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDK
  QSSQRMRQNLKLLVEETSCQQNMIQELIETNQQLRNELQLEQSRAANQEQRANDLEQIME
  SVKSKIGELEDESLSRACHQQNKIKDLQKEQKTLQVKCQHYKKKRTEQEETIASLQMEVC
  RLKKEEEDRIVTQNRVFAYLCKRVPHTVLDRQLLCLIDYYESKIRKIHTQRQYKEDESQS
  EEENDYRNLDASPTYKGLLMSLQNQLKESKSKIDALSSEKLNLQKDLETRPTQHELRLYK
  QQVKKLEKALKKNVKLQELINHKKAEDTEKKDEPSKYNQQQALIDQRYFQVLCSINSIIH
  NPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAEL
  VPWLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPHFQTLQAIVSHFQKLFDVP
  SLNGVYPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQV
  MQVLGPEDLQSIIYKLEEHEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKLKVLSY

• Sequence length: 597

Pathways

Reactome Pathway

Regulation of PLK1 Activity at G2/M Transition

Loss of Nlp from mitotic centrosomes

Recruitment of mitotic centrosome proteins and complexes

Loss of proteins required for interphase microtubule organization from the centrosome

Recruitment of NuMA to mitotic centrosomes

Anchoring of the basal body to the plasma membrane

AURKA Activation by TPX2

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Median cleft lip and palate	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (18)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anorexia Nervosa	Anorexia	BEFREE	31398429		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	33980814	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28063737, 28632150		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28063737	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28109768, 28632150	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	29631575		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20616015	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28696795		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	33980814	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28063737, 28632150		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26893288		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29891487		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28063737, 28811962, 29760047		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28025583		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26893288, 28063737		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26893288		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29891487		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28696795		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SDCCAG8 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes. CEP250 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes. HAUS1 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes. NEDD1 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes. CEP164 7 shared pathwaysRegulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes, Recruitment of mitotic centrosome proteins and complexes, Loss of proteins required for interphase microtubule organization from the centrosome, Recruitment of NuMA to mitotic centrosomes, Anchoring of the basal body to the plasma membrane, AURKA Activation by TPX2 Related via 7 shared pathways including Regulation of PLK1 Activity at G2/M Transition, Loss of Nlp from mitotic centrosomes.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SDCCAG8	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]
CEP250	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]
HAUS1	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]
NEDD1	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]
CEP164	0	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	0	[]

Diseases Linked via Similar Genes

Retinitis pigmentosa Linked via 3 of 5 related genesSDCCAG8, CEP250, CEP164 Ciliopathy Linked via 2 of 5 related genesSDCCAG8, CEP164 Metabolic syndrome Linked via 2 of 5 related genesSDCCAG8, CEP164 Nephronophthisis Linked via 2 of 5 related genesSDCCAG8, CEP164 Senior-loken syndrome Linked via 2 of 5 related genesSDCCAG8, CEP164

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Retinitis pigmentosa	3	["SDCCAG8","CEP250","CEP164"]
Ciliopathy	2	["SDCCAG8","CEP164"]
Metabolic syndrome	2	["SDCCAG8","CEP164"]
Nephronophthisis	2	["SDCCAG8","CEP164"]
Senior-loken syndrome	2	["SDCCAG8","CEP164"]