CD22 (CD22 molecule)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 933
• Gene name: CD22 molecule
• Gene symbol: CD22
• Synonyms (NCBI Gene): SIGLEC-2, SIGLEC2
• Chromosome: 19
• Chromosome location: 19q13.12

miRNA Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017296	hsa-miR-335-5p	Microarray	18185580
MIRT438478	hsa-miR-19a-3p	qRT-PCR, Western blot	24169826
MIRT438478	hsa-miR-19a-3p	qRT-PCR, Western blot	24169826
MIRT874136	hsa-miR-1207-5p	CLIP-seq
MIRT874137	hsa-miR-1909	CLIP-seq
MIRT874138	hsa-miR-3677-5p	CLIP-seq
MIRT874139	hsa-miR-4447	CLIP-seq
MIRT874140	hsa-miR-4472	CLIP-seq
MIRT874141	hsa-miR-4488	CLIP-seq
MIRT874142	hsa-miR-4697-5p	CLIP-seq
MIRT874143	hsa-miR-4716-3p	CLIP-seq
MIRT874144	hsa-miR-4763-3p	CLIP-seq
MIRT874145	hsa-miR-486-3p	CLIP-seq
MIRT874146	hsa-miR-541	CLIP-seq
MIRT874147	hsa-miR-654-5p	CLIP-seq
MIRT2196241	hsa-miR-4450	CLIP-seq
MIRT2196242	hsa-miR-4459	CLIP-seq
MIRT2196243	hsa-miR-4481	CLIP-seq
MIRT2196244	hsa-miR-4722-5p	CLIP-seq
MIRT2196245	hsa-miR-4745-5p	CLIP-seq
MIRT2196246	hsa-miR-4783-5p	CLIP-seq
MIRT2196247	hsa-miR-4786-3p	CLIP-seq
MIRT2196248	hsa-miR-491-5p	CLIP-seq
MIRT2196249	hsa-miR-671-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SPI1	Unknown	15892171
STAT1	Activation	12855573

Gene ontology (GO) Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001791	Function	IgM binding	TAS	15240561
GO:0002638	Process	Negative regulation of immunoglobulin production	IEA
GO:0002638	Process	Negative regulation of immunoglobulin production	ISS
GO:0002683	Process	Negative regulation of immune system process	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	15240561
GO:0005515	Function	Protein binding	IPI	8627166, 8647200, 32296183
GO:0005737	Component	Cytoplasm	TAS	15240561
GO:0005769	Component	Early endosome	IBA
GO:0005769	Component	Early endosome	IDA	17562860
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	15240561
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	NAS	7925291
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	15240561
GO:0019903	Function	Protein phosphatase binding	IBA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0019903	Function	Protein phosphatase binding	ISS
GO:0019903	Function	Protein phosphatase binding	TAS	15095367
GO:0030100	Process	Regulation of endocytosis	IDA	17562860
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030888	Process	Regulation of B cell proliferation	IBA
GO:0030888	Process	Regulation of B cell proliferation	IEA
GO:0030888	Process	Regulation of B cell proliferation	ISS
GO:0032809	Component	Neuronal cell body membrane	IEA
GO:0032809	Component	Neuronal cell body membrane	ISS
GO:0033691	Function	Sialic acid binding	IBA
GO:0033691	Function	Sialic acid binding	IEA
GO:0033691	Function	Sialic acid binding	ISS
GO:0033691	Function	Sialic acid binding	TAS	15240561
GO:0042113	Process	B cell activation	IBA
GO:0042113	Process	B cell activation	IDA	26017478
GO:0042609	Function	CD4 receptor binding	IBA
GO:0042609	Function	CD4 receptor binding	IEA
GO:0042609	Function	CD4 receptor binding	ISS
GO:0050776	Process	Regulation of immune response	IEA
GO:0050776	Process	Regulation of immune response	ISS
GO:0050849	Process	Negative regulation of calcium-mediated signaling	IEA
GO:0050849	Process	Negative regulation of calcium-mediated signaling	ISS
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IBA
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IDA	26017478
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IMP	24169826
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	TAS	15240561
GO:0055037	Component	Recycling endosome	IBA
GO:0055037	Component	Recycling endosome	IDA	17562860
GO:0070062	Component	Extracellular exosome	HDA	20458337

Other IDs

• MIM: 107266
• HGNC: 1643
• e!Ensembl: ENSG00000012124

Protein

• UniProt ID: P20273
• Protein name: B-cell receptor CD22 (B-lymphocyte cell adhesion molecule) (BL-CAM) (Sialic acid-binding Ig-like lectin 2) (Siglec-2) (T-cell surface antigen Leu-14) (CD antigen CD22)
• Protein function: Most highly expressed siglec (sialic acid-binding immunoglobulin-like lectin) on B-cells that plays a role in various aspects of B-cell biology including differentiation, antigen presentation, and trafficking to bone marrow (PubMed:34330755, Pub
• PDB: 5VKJ , 5VKM , 5VL3 , 7O52
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08205	C2-set_2	143 → 230	CD80-like C2-set immunoglobulin domain	Domain
  PF13895	Ig_2	510 → 589	Immunoglobulin domain	Domain
  PF13927	Ig_3	242 → 313		Domain
  PF13927	Ig_3	597 → 663		Domain
  PF13927	Ig_3	331 → 400		Domain

• Tissue specificity: TISSUE SPECIFICITY: B-lymphocytes.
• Sequence:

  MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFH
  NPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLR
  MESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEG
  VPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKH
  TPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVT
  KDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPL
  PTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK
  KVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNT
  TIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQ
  FFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSM
  SPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQ
  GTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQG
  LQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMNIPRTGDAES
  SEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENV
  DYVILKH

• Sequence length: 847

Pathways

KEGG Pathway	Reactome Pathway
Cell adhesion molecules	Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Hematopoietic cell lineage	CD22 mediated BCR regulation
B cell receptor signaling pathway	Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (7)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (108)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	12526923, 8501986		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12592332, 1696310, 19143872, 19792972, 21348573, 22017452, 22327430, 23486472, 25567759, 25728039, 26288837, 27486888, 27689397, 28423727, 28449314, 28819740, 28859185, 29296758, 29352703, 30087554, 30763199, 31039409, 31566728, 7532767, 7686604		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	29045509		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	29045509	Associate	★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12592332, 19792972, 21348573, 25728039, 26288837, 28423727, 28859185, 30087554, 30763199, 31039409, 7532767, 7686604		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	15892171, 25708834, 27964867, 31753002		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	21247474	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	21247474		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	15050965		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	2969703, 31882654	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33459349	Inhibit	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	32366930	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10079291, 15277237, 16227086, 22777817, 23083346, 24841380, 26752092, 28970495, 29903053, 30143587, 30323814, 30559744, 31095840, 31616406		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	27808110	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	31714901	Associate	★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	30372691		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	15693135, 18453625, 20628151, 22048691, 22777817, 26017478, 28829594, 28972089, 3509751, 7493380, 8643111		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	32394645	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30979742		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34990474	Associate	★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	17055225		★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	BEFREE	25196579, 28687420, 30090971, 30842058		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	10438726, 24395821, 27808110	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	8209868		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30355653	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24395821		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33907270	Associate	★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney complex	Pubtator	34273351	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	12592332, 19792972, 21348573, 22509046, 25728039, 26288837, 28423727, 28859185, 28983018, 30763199, 31039409, 31110217, 7532767, 7686604		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11948105, 18431797, 27689397, 29602219, 8334643		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34975867	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	8542947		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	23083346		★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	17493148		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	15892171, 25708834, 27964867, 31753002		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37817249	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26744869		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26744869	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26744869		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35845958	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	33725422	Associate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	11948105, 22509046, 23486472, 24931452, 25563425, 28423727, 30030507, 30357593, 31068044, 31187521		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	37295816	Stimulate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	10778980, 23927500, 25304309, 28374962, 28970495, 30120894		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	24952935, 37295816, 37817249	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	24931452		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	29572500	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	30482769, 30504288		★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	3509751		★☆☆☆☆ Found in Text Mining only
Immune Complex Diseases	Immune Complex Diseases	BEFREE	31262443		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10778980, 1696310, 20628151, 20841423, 22777817, 25567759, 25889802, 26288837, 30120708, 31110075, 31578576, 8643111		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12010811, 19382197, 20628151, 22048691, 27018867, 27689397, 2784064, 29572500, 31110075, 32312992, 34706776, 35015683, 35015686, 35222407, 35421218, 40362518, 7513207	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	20872890	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	23347903, 27808110, 30030507, 38440808, 8537498, 8602628	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	3258772, 33957373, 34793513	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23955454		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25304155, 30355653		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29869007		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24395821, 28230015	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21050432, 21398610	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10079291, 11288756, 23083346, 23821660, 29381843, 29542345, 30323814, 31316634		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37817249	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	34525183	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	1696310, 19143872		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10778980, 2065296, 25889802, 26230248, 26285772, 29922424, 31578576, 3509751, 8643111		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21629223, 24862406	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	11877756	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	20872890	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	22327430, 27524505, 28009435, 29142069		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	22327430, 27524505		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	25957418		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	30834235		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30979742		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24395821		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11948105, 18678888, 18988862, 22048691, 25567759, 26826117, 27689397, 28009435, 28039694, 28423727, 29316610, 29369629, 29543347, 29662041, 29903053, 30030507, 30834235, 30979742, 31095840		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	19821820, 28423727		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	30696068	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27411958, 29045509		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	27411958	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	24841380		★☆☆☆☆ Found in Text Mining only
Monoclonal B-Cell Lymphocytosis	B-Cell Lymphocytosis	BEFREE	28187524		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15068900		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	9649209	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	9031614		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27350400	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12429643, 15850802, 18474217, 1884024, 20841423, 24317514, 25957418, 26285772		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C1	Sphingomyelinase deficiency	BEFREE	29617956		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	23927500, 29155426, 31110217		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	23927500, 24579885, 25728039, 27486888, 28152223, 29508899, 30442119, 31110217, 31182121, 31808880, 8683996		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	24579885, 25728039, 27486888, 30807395		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	1696310, 19143872, 21348573, 22327430, 23486472, 25567759, 25728039, 27486888, 27689397, 28449314, 29296758, 30087554		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	19792972, 20008222		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10079291, 30835424		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	38182638	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma, Limited	Scleroderma	BEFREE	17493148		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	26017478	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	15050965, 26017478		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	16859536	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	25957418		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	34529670	Associate	★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	8334643		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26811494	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	17493148, 19919568, 21961844, 29869007		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	17493148		★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	32394645	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36768478	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	9031614		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	25655603		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CD34 3 shared pathwaysCell adhesion molecules, Hematopoietic cell lineage, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 3 shared pathways including Cell adhesion molecules, Hematopoietic cell lineage. CD79B 3 shared pathwaysB cell receptor signaling pathway, Antigen activates B Cell Receptor (BCR) leading to generation of second messengers, CD22 mediated BCR regulation Related via 3 shared pathways including B cell receptor signaling pathway, Antigen activates B Cell Receptor (BCR) leading to generation of second messengers. CD79A 3 shared pathwaysB cell receptor signaling pathway, Antigen activates B Cell Receptor (BCR) leading to generation of second messengers, CD22 mediated BCR regulation Related via 3 shared pathways including B cell receptor signaling pathway, Antigen activates B Cell Receptor (BCR) leading to generation of second messengers. CD226 2 shared pathwaysCell adhesion molecules, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 2 shared pathways including Cell adhesion molecules, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. SIGLEC1 2 shared pathwaysCell adhesion molecules, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 2 shared pathways including Cell adhesion molecules, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CD34	0	[]	3	["Cell adhesion molecules","Hematopoietic cell lineage","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell"]	0	[]
CD79B	0	[]	3	["B cell receptor signaling pathway","Antigen activates B Cell Receptor (BCR) leading to generation of second messengers","CD22 mediated BCR regulation"]	0	[]
CD79A	0	[]	3	["B cell receptor signaling pathway","Antigen activates B Cell Receptor (BCR) leading to generation of second messengers","CD22 mediated BCR regulation"]	0	[]
CD226	0	[]	2	["Cell adhesion molecules","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell"]	0	[]
SIGLEC1	0	[]	2	["Cell adhesion molecules","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell"]	0	[]

Diseases Linked via Similar Genes

Agammaglobulinemia Linked via 2 of 5 related genesCD79B, CD79A Diffuse large b-cell lymphoma Linked via 2 of 5 related genesCD79B, CD79A Alzheimer disease Linked via 1 of 5 related genesCD34 Breast cancer Linked via 1 of 5 related genesCD34 Hepatocellular carcinoma Linked via 1 of 5 related genesCD34

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Agammaglobulinemia	2	["CD79B","CD79A"]
Diffuse large b-cell lymphoma	2	["CD79B","CD79A"]
Alzheimer disease	1	["CD34"]
Breast cancer	1	["CD34"]
Hepatocellular carcinoma	1	["CD34"]