CCNB1 (cyclin B1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 891
• Gene name: Cyclin B1
• Gene symbol: CCNB1
• Synonyms (NCBI Gene): CCNB
• Chromosome: 5
• Chromosome location: 5q13.2
• Summary: The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the

miRNA Show/Hide all (249)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021866	hsa-miR-132-3p	Western blot;qRT-PCR	21329664
MIRT024969	hsa-miR-212-3p	Western blot;qRT-PCR	21329664
MIRT030588	hsa-miR-24-3p	Microarray	19748357
MIRT051879	hsa-let-7b-5p	CLASH	23622248
MIRT050578	hsa-miR-20a-5p	CLASH	23622248
MIRT049477	hsa-miR-92a-3p	CLASH	23622248
MIRT047127	hsa-miR-183-5p	CLASH	23622248
MIRT054743	hsa-miR-548b-3p	Luciferase reporter assay, Immunofluorescence analysis, qRT-PCR	24832599
MIRT054743	hsa-miR-548b-3p	Luciferase reporter assay, Immunofluorescence analysis, qRT-PCR	24832599
MIRT704898	hsa-miR-6089	HITS-CLIP	23313552
MIRT704897	hsa-miR-6134	HITS-CLIP	23313552
MIRT704896	hsa-miR-4649-5p	HITS-CLIP	23313552
MIRT704895	hsa-miR-6729-5p	HITS-CLIP	23313552
MIRT704894	hsa-miR-541-3p	HITS-CLIP	23313552
MIRT704893	hsa-miR-654-5p	HITS-CLIP	23313552
MIRT688795	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT688794	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT688793	hsa-miR-4257	HITS-CLIP	23313552
MIRT688792	hsa-miR-3192-5p	HITS-CLIP	23313552
MIRT688791	hsa-miR-3160-3p	HITS-CLIP	23313552
MIRT688790	hsa-miR-558	HITS-CLIP	23313552
MIRT688789	hsa-miR-4487	HITS-CLIP	23313552
MIRT688788	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT688787	hsa-miR-6086	HITS-CLIP	23313552
MIRT688786	hsa-miR-2467-3p	HITS-CLIP	23313552
MIRT688785	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT688784	hsa-miR-3612	HITS-CLIP	23313552
MIRT688783	hsa-miR-650	HITS-CLIP	23313552
MIRT688782	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT688781	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT314110	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT314112	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT568135	hsa-miR-508-5p	PAR-CLIP	20371350
MIRT568134	hsa-miR-1278	PAR-CLIP	20371350
MIRT359007	hsa-miR-192-3p	PAR-CLIP	20371350
MIRT314110	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT314112	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT568135	hsa-miR-508-5p	PAR-CLIP	20371350
MIRT568134	hsa-miR-1278	PAR-CLIP	20371350
MIRT359007	hsa-miR-192-3p	PAR-CLIP	20371350
MIRT047127	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT216352	hsa-miR-548n	PAR-CLIP	20371350
MIRT216348	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT216358	hsa-miR-548ab	PAR-CLIP	20371350
MIRT216359	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT216360	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT216361	hsa-miR-548ak	PAR-CLIP	20371350
MIRT216363	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT216365	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT216366	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT216367	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT216368	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT216370	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT216371	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT216347	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT216372	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT216349	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT216350	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT216353	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT216354	hsa-miR-548i	PAR-CLIP	20371350
MIRT216351	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT216357	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT216355	hsa-miR-548w	PAR-CLIP	20371350
MIRT216356	hsa-miR-548y	PAR-CLIP	20371350
MIRT216346	hsa-miR-559	PAR-CLIP	20371350
MIRT216362	hsa-miR-4517	PAR-CLIP	20371350
MIRT216369	hsa-miR-5583-3p	PAR-CLIP	20371350
MIRT359013	hsa-miR-5683	PAR-CLIP	20371350
MIRT216364	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT359012	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT532068	hsa-miR-4477a	PAR-CLIP	20371350
MIRT359005	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT359008	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT359014	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT359015	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT314136	hsa-miR-3163	PAR-CLIP	20371350
MIRT359014	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT359015	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT216352	hsa-miR-548n	PAR-CLIP	22012620
MIRT532070	hsa-miR-548az-5p	PAR-CLIP	22012620
MIRT532069	hsa-miR-548t-5p	PAR-CLIP	22012620
MIRT216348	hsa-miR-548a-5p	PAR-CLIP	22012620
MIRT216358	hsa-miR-548ab	PAR-CLIP	22012620
MIRT216359	hsa-miR-548ad-5p	PAR-CLIP	22012620
MIRT216360	hsa-miR-548ae-5p	PAR-CLIP	22012620
MIRT216361	hsa-miR-548ak	PAR-CLIP	22012620
MIRT216363	hsa-miR-548am-5p	PAR-CLIP	22012620
MIRT216365	hsa-miR-548ap-5p	PAR-CLIP	22012620
MIRT216366	hsa-miR-548aq-5p	PAR-CLIP	22012620
MIRT216367	hsa-miR-548ar-5p	PAR-CLIP	22012620
MIRT216368	hsa-miR-548as-5p	PAR-CLIP	22012620
MIRT216370	hsa-miR-548au-5p	PAR-CLIP	22012620
MIRT216371	hsa-miR-548ay-5p	PAR-CLIP	22012620
MIRT216347	hsa-miR-548b-5p	PAR-CLIP	22012620
MIRT216372	hsa-miR-548bb-5p	PAR-CLIP	22012620
MIRT216349	hsa-miR-548c-5p	PAR-CLIP	22012620
MIRT216350	hsa-miR-548d-5p	PAR-CLIP	22012620
MIRT216353	hsa-miR-548h-5p	PAR-CLIP	22012620
MIRT216354	hsa-miR-548i	PAR-CLIP	22012620
MIRT216351	hsa-miR-548j-5p	PAR-CLIP	22012620
MIRT216357	hsa-miR-548o-5p	PAR-CLIP	22012620
MIRT216355	hsa-miR-548w	PAR-CLIP	22012620
MIRT216356	hsa-miR-548y	PAR-CLIP	22012620
MIRT216346	hsa-miR-559	PAR-CLIP	22012620
MIRT216362	hsa-miR-4517	PAR-CLIP	22012620
MIRT216369	hsa-miR-5583-3p	PAR-CLIP	22012620
MIRT359013	hsa-miR-5683	PAR-CLIP	22012620
MIRT216364	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT532068	hsa-miR-4477a	PAR-CLIP	22012620
MIRT359005	hsa-let-7a-2-3p	PAR-CLIP	22012620
MIRT359008	hsa-let-7g-3p	PAR-CLIP	22012620
MIRT688791	hsa-miR-3160-3p	PAR-CLIP	26701625
MIRT688791	hsa-miR-3160-3p	PAR-CLIP	26701625
MIRT688791	hsa-miR-3160-3p	PAR-CLIP	26701625
MIRT688789	hsa-miR-4487	PAR-CLIP	26701625
MIRT688789	hsa-miR-4487	PAR-CLIP	26701625
MIRT688789	hsa-miR-4487	PAR-CLIP	26701625
MIRT568135	hsa-miR-508-5p	PAR-CLIP	26701625
MIRT568135	hsa-miR-508-5p	PAR-CLIP	26701625
MIRT568135	hsa-miR-508-5p	PAR-CLIP	26701625
MIRT688790	hsa-miR-558	PAR-CLIP	26701625
MIRT688790	hsa-miR-558	PAR-CLIP	26701625
MIRT688790	hsa-miR-558	PAR-CLIP	26701625
MIRT049477	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT049477	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT049477	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT732757	hsa-miR-125b-5p	Luciferase reporter assay, Western blotting	33859745
MIRT732822	hsa-miR-183-3p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	31605132
MIRT704898	hsa-miR-6089	HITS-CLIP	23313552
MIRT704897	hsa-miR-6134	HITS-CLIP	23313552
MIRT704896	hsa-miR-4649-5p	HITS-CLIP	23313552
MIRT704895	hsa-miR-6729-5p	HITS-CLIP	23313552
MIRT704894	hsa-miR-541-3p	HITS-CLIP	23313552
MIRT704893	hsa-miR-654-5p	HITS-CLIP	23313552
MIRT688795	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT688794	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT688793	hsa-miR-4257	HITS-CLIP	23313552
MIRT688792	hsa-miR-3192-5p	HITS-CLIP	23313552
MIRT688791	hsa-miR-3160-3p	HITS-CLIP	23313552
MIRT688790	hsa-miR-558	HITS-CLIP	23313552
MIRT688789	hsa-miR-4487	HITS-CLIP	23313552
MIRT688788	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT688787	hsa-miR-6086	HITS-CLIP	23313552
MIRT688786	hsa-miR-2467-3p	HITS-CLIP	23313552
MIRT688785	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT688784	hsa-miR-3612	HITS-CLIP	23313552
MIRT688783	hsa-miR-650	HITS-CLIP	23313552
MIRT688782	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT688781	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT314110	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT314112	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT568135	hsa-miR-508-5p	PAR-CLIP	20371350
MIRT568134	hsa-miR-1278	PAR-CLIP	20371350
MIRT359007	hsa-miR-192-3p	PAR-CLIP	20371350
MIRT314110	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT314112	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT568135	hsa-miR-508-5p	PAR-CLIP	20371350
MIRT568134	hsa-miR-1278	PAR-CLIP	20371350
MIRT359007	hsa-miR-192-3p	PAR-CLIP	20371350
MIRT047127	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT216352	hsa-miR-548n	PAR-CLIP	20371350
MIRT216348	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT216358	hsa-miR-548ab	PAR-CLIP	20371350
MIRT216359	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT216360	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT216361	hsa-miR-548ak	PAR-CLIP	20371350
MIRT216363	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT216365	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT216366	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT216367	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT216368	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT216370	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT216371	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT216347	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT216372	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT216349	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT216350	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT216353	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT216354	hsa-miR-548i	PAR-CLIP	20371350
MIRT216351	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT216357	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT216355	hsa-miR-548w	PAR-CLIP	20371350
MIRT216356	hsa-miR-548y	PAR-CLIP	20371350
MIRT216346	hsa-miR-559	PAR-CLIP	20371350
MIRT216362	hsa-miR-4517	PAR-CLIP	20371350
MIRT216369	hsa-miR-5583-3p	PAR-CLIP	20371350
MIRT359013	hsa-miR-5683	PAR-CLIP	20371350
MIRT216364	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT359012	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT532068	hsa-miR-4477a	PAR-CLIP	20371350
MIRT359005	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT359008	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT359014	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT359015	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT314136	hsa-miR-3163	PAR-CLIP	20371350
MIRT359014	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT359015	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT216352	hsa-miR-548n	PAR-CLIP	22012620
MIRT532070	hsa-miR-548az-5p	PAR-CLIP	22012620
MIRT532069	hsa-miR-548t-5p	PAR-CLIP	22012620
MIRT216348	hsa-miR-548a-5p	PAR-CLIP	22012620
MIRT216358	hsa-miR-548ab	PAR-CLIP	22012620
MIRT216359	hsa-miR-548ad-5p	PAR-CLIP	22012620
MIRT216360	hsa-miR-548ae-5p	PAR-CLIP	22012620
MIRT216361	hsa-miR-548ak	PAR-CLIP	22012620
MIRT216363	hsa-miR-548am-5p	PAR-CLIP	22012620
MIRT216365	hsa-miR-548ap-5p	PAR-CLIP	22012620
MIRT216366	hsa-miR-548aq-5p	PAR-CLIP	22012620
MIRT216367	hsa-miR-548ar-5p	PAR-CLIP	22012620
MIRT216368	hsa-miR-548as-5p	PAR-CLIP	22012620
MIRT216370	hsa-miR-548au-5p	PAR-CLIP	22012620
MIRT216371	hsa-miR-548ay-5p	PAR-CLIP	22012620
MIRT216347	hsa-miR-548b-5p	PAR-CLIP	22012620
MIRT216372	hsa-miR-548bb-5p	PAR-CLIP	22012620
MIRT216349	hsa-miR-548c-5p	PAR-CLIP	22012620
MIRT216350	hsa-miR-548d-5p	PAR-CLIP	22012620
MIRT216353	hsa-miR-548h-5p	PAR-CLIP	22012620
MIRT216354	hsa-miR-548i	PAR-CLIP	22012620
MIRT216351	hsa-miR-548j-5p	PAR-CLIP	22012620
MIRT216357	hsa-miR-548o-5p	PAR-CLIP	22012620
MIRT216355	hsa-miR-548w	PAR-CLIP	22012620
MIRT216356	hsa-miR-548y	PAR-CLIP	22012620
MIRT216346	hsa-miR-559	PAR-CLIP	22012620
MIRT216362	hsa-miR-4517	PAR-CLIP	22012620
MIRT216369	hsa-miR-5583-3p	PAR-CLIP	22012620
MIRT359013	hsa-miR-5683	PAR-CLIP	22012620
MIRT216364	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT532068	hsa-miR-4477a	PAR-CLIP	22012620
MIRT359005	hsa-let-7a-2-3p	PAR-CLIP	22012620
MIRT359008	hsa-let-7g-3p	PAR-CLIP	22012620
MIRT755571	hsa-miR-449a	Western blotting	36545680
MIRT755878	hsa-miR?139-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35181869
MIRT871220	hsa-miR-1305	CLIP-seq
MIRT871221	hsa-miR-183	CLIP-seq
MIRT871222	hsa-miR-3609	CLIP-seq
MIRT871223	hsa-miR-3973	CLIP-seq
MIRT871224	hsa-miR-4699-5p	CLIP-seq
MIRT871225	hsa-miR-4709-3p	CLIP-seq
MIRT871226	hsa-miR-4717-3p	CLIP-seq
MIRT871227	hsa-miR-520g	CLIP-seq
MIRT871228	hsa-miR-520h	CLIP-seq
MIRT871229	hsa-miR-548ah	CLIP-seq
MIRT871230	hsa-miR-548h	CLIP-seq
MIRT871231	hsa-miR-548j	CLIP-seq
MIRT871232	hsa-miR-548t	CLIP-seq
MIRT871233	hsa-miR-561	CLIP-seq
MIRT871234	hsa-miR-607	CLIP-seq
MIRT2385709	hsa-miR-3671	CLIP-seq
MIRT871234	hsa-miR-607	CLIP-seq

Transcription factors Show/Hide all (19)

Transcription factor	Regulation	Reference
BRCA1	Unknown	12647291
E2F1	Unknown	22508987
E2F3	Unknown	17098936
E2F4	Unknown	22508987
FOXM1	Activation	19276163
IRF1	Repression	22200613
KLF4	Repression	14627709
KLF5	Activation	21951574
MYC	Unknown	11522645
NFKB1	Activation	11861406
NFKB1	Unknown	19610058
PTTG1	Activation	22475756
RELA	Activation	11861406
RELA	Unknown	19610058
TBP	Unknown	17098936
TFAP2A	Unknown	7739559
TP53	Repression	11892838
USF1	Unknown	10548544
YBX1	Repression	20596676

Gene ontology (GO) Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000086	Process	G2/M transition of mitotic cell cycle	NAS	17495531
GO:0000922	Component	Spindle pole	IDA	18195732
GO:0000940	Component	Outer kinetochore	IDA	18195732
GO:0001556	Process	Oocyte maturation	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0005113	Function	Patched binding	IPI	11331587
GO:0005515	Function	Protein binding	IPI	8756624, 9001210, 10373560, 12612082, 15790566, 17283331, 18337751, 18408765, 19502428, 19879842, 20965177, 21540187, 21952639, 23397142, 23455922, 23543736, 23602568, 23799914, 24358021, 25852190, 26496610, 27626412, 28514442, 32707033, 33037310, 33961781, 34591612, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11331587, 16109376, 20725088
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11331587, 17850284, 20725088
GO:0005737	Component	Cytoplasm	IEA
GO:0005759	Component	Mitochondrial matrix	IBA
GO:0005759	Component	Mitochondrial matrix	IDA	24746669
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005813	Component	Centrosome	IDA	12524548
GO:0005813	Component	Centrosome	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0007052	Process	Mitotic spindle organization	IMP	18195732
GO:0007080	Process	Mitotic metaphase chromosome alignment	IBA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	18195732
GO:0007283	Process	Spermatogenesis	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IDA	24746669
GO:0016020	Component	Membrane	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	12524548, 24746669
GO:0031442	Process	Positive regulation of mRNA 3'-end processing	IEA
GO:0042246	Process	Tissue regeneration	IEA
GO:0044389	Function	Ubiquitin-like protein ligase binding	IPI	15749827
GO:0044772	Process	Mitotic cell cycle phase transition	IEA
GO:0045787	Process	Positive regulation of cell cycle	IEA
GO:0045931	Process	Positive regulation of mitotic cell cycle	IMP	18195732
GO:0046680	Process	Response to DDT	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048565	Process	Digestive tract development	IEA
GO:0051301	Process	Cell division	IEA
GO:0051987	Process	Positive regulation of attachment of spindle microtubules to kinetochore	IMP	18195732
GO:0055015	Process	Ventricular cardiac muscle cell development	IEA
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0060623	Process	Regulation of chromosome condensation	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IDA	24746669
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0071283	Process	Cellular response to iron(III) ion	IEA
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0090266	Process	Regulation of mitotic cell cycle spindle assembly checkpoint	IMP	18195732
GO:0097125	Component	Cyclin B1-CDK1 complex	IBA
GO:0097125	Component	Cyclin B1-CDK1 complex	IDA	24746669
GO:0097125	Component	Cyclin B1-CDK1 complex	IPI	17495531
GO:1905448	Process	Positive regulation of mitochondrial ATP synthesis coupled electron transport	IDA	24746669

Other IDs

• MIM: 123836
• HGNC: 1579
• e!Ensembl: ENSG00000134057

Protein

• UniProt ID: P14635
• Protein name: G2/mitotic-specific cyclin-B1
• Protein function: Essential for the control of the cell cycle at the G2/M (mitosis) transition.
• PDB: 2B9R , 2JGZ , 4Y72 , 4YC3 , 5HQ0 , 5LQF , 6GU2 , 6GU3 , 6GU4 , 7NJ0 , 8TAR , 8TAU , 9FH9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00134	Cyclin_N	173 → 298	Cyclin, N-terminal domain	Domain
  PF02984	Cyclin_C	300 → 418	Cyclin, C-terminal domain	Domain

• Sequence:

  MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
  PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI
  LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
  LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP
  KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
  LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
  WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
  ALVQDLAKAVAKV

• Sequence length: 433

Pathways

KEGG Pathway	Reactome Pathway
FoxO signaling pathway	Polo-like kinase mediated events
Cell cycle	APC/C:Cdc20 mediated degradation of Cyclin B
Oocyte meiosis	Regulation of APC/C activators between G1/S and early anaphase
p53 signaling pathway	Phosphorylation of the APC/C
Cellular senescence	Phosphorylation of Emi1
Progesterone-mediated oocyte maturation	Condensation of Prophase Chromosomes
Human immunodeficiency virus 1 infection	Resolution of Sister Chromatid Cohesion
	Regulation of PLK1 Activity at G2/M Transition
	Activation of NIMA Kinases NEK9, NEK6, NEK7
	Initiation of Nuclear Envelope (NE) Reformation
	Nuclear Pore Complex (NPC) Disassembly
	Depolymerisation of the Nuclear Lamina
	TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
	Mitotic Prophase
	Cyclin A/B1/B2 associated events during G2/M transition
	G2/M DNA replication checkpoint
	Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex
	The role of GTSE1 in G2/M progression after G2 checkpoint
	Transcriptional regulation by RUNX2

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	28284560	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	34837450	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	21411543	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	29464035	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (220)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	16619512		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15809747		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30556321		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	9268294		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	19218281		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	32147961, 32207273, 35983531, 38053725	Associate	★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	31541075		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	12360402		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	19218281		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	16479598, 17596434, 9525997	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	15152009	Associate	★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	39358545	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	19218281		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	31173250	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10656729	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	23335992, 29863983		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24860838	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	16273239		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26238718		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	11815979	Associate	★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	24840883		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	37335738	Associate	★☆☆☆☆ Found in Text Mining only
Benign Meningioma	Benign Meningioma	BEFREE	22137483		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	24860838, 31187492		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30355928, 30414902, 31828101		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11305412		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	11305412	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19470724, 21761201, 22362714, 23874748, 24386390, 25408372, 29795334, 30327455, 9515786, 9631067		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10934345, 11696596, 19293801, 19470724, 20127686, 21488187, 21785467, 21918689, 22362714, 22580043, 23506640, 23562353, 23874748, 24386390, 24852823, 25254601, 25408372, 25687451, 29196913, 29693125, 30320388, 31895772, 32705365, 33128008, 33285689, 33455094, 33499770, 33674187, 34384030, 34454978, 34745136, 35445733, 35447458, 35456460, 35949045, 36040381, 36307489, 36360219, 36418517, 36591654, 36692465, 37049472, 37190094, 37831636, 38581717	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21338529, 23722120, 37758792	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	15154011	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20334896		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	37861550	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	33335279, 9006317	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	19259937	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	29633253	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15298730, 20515845, 21625435, 22682366, 24455688, 26259250, 29728556, 29977454, 30272310, 30341252, 30702595, 30981109, 31043166, 31737652, 31746405, 31822116, 32627011, 32687483, 32722976, 32769939, 32863381, 33099931, 33157984, 33390802, 33750838, 33776365, 33946043, 34044639, 34112092, 34257537, 34337056, 34603487, 34743578, 34746301, 35078445, 36002253, 36244757, 36317111, 36403263, 36479313, 36553600, 37861550, 38025683, 39849382	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30228980, 30363964	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	33335279	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	9006317	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	15154011	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30355928, 30414902, 31828101		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11162602, 16984381, 26512878, 29448242		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19032793, 28713952, 33726773, 34794761	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	10935512, 29483831, 36167975	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10623670, 28984208, 37464398, 37758792	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	15154011	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16832409, 17998647, 21136231, 23722120, 25849598, 31035650, 36714024, 37442189	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	29633253		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22579115, 28713952		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	31700112	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	35485294	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	20661218, 31605132		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	20661218, 31605132		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	31541075		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	17294242, 36224755	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23121546, 31746435		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	26555773	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	15297175		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	37216802	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22574716, 27344083		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	25263446		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27513421	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23625650, 24971465, 25800793, 25962181, 26506418, 28923355, 29221213, 9030252		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16160080, 19550124, 26040697, 26506418, 31087508, 31173250, 31630568, 33190424, 33744866, 34373442, 35053185, 35774271, 36123948, 36820595, 9030252	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25962181	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	17294242		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21304051, 29187877		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	23217276, 29899865		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	23363935	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	36543921	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30474315	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32633001	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Neoplasm	Embryonal Neoplasm	BEFREE	26029996		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12931023, 16430474, 31056798		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	12931023		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	11570574, 35128857	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	18353325		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18353325, 35303800	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28713952		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	18609681, 29221213		★☆☆☆☆ Found in Text Mining only
Esophageal Diseases	Esophageal Diseases	LHGDN	12115375		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	12115375, 18609681, 27585443, 34232175, 35484963	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	18609681, 29221213		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	12115375, 22631645, 23114644, 24817950, 27588470, 34232175, 35484963, 37168048	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	24714775		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	24714775		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28412732		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	37480569	Associate	★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	LHGDN	17359356		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	20037601		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	14724156	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	17521702, 25982682		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11875718, 17324379, 17638400, 26678675, 29901201, 30009775, 30912292		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11875718, 29901201, 34018447, 34433903	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17324379, 17638400, 26678675, 29901201, 30009775		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12449730, 30009775		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17998647, 18492260, 30405856, 8723902	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	15100731	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	19470724	Associate	★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	37480569	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	21488187, 9006317	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	24840883		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21174181	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	24026482	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	34858418, 36175893	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	12757604	Associate	★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	16832409	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	25748237	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12009577		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17655707		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	9627219	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	12360402		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18393292, 20515845, 21419759, 21802841, 22241220, 22682366, 23812424, 29705704, 29805683, 30651720, 31007608		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37861550	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	29705704		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	19505905	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12878869, 20504322, 24441772, 25242136, 29448242, 30260967, 32596300, 32831194, 36035842, 36714024, 36984548, 37587486	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37986322	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18507053	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34797837	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17722244, 25962181, 30487595, 37168048	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12068134	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	15576476	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	15576476		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Malformation of cortical development	LHGDN	17359356		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	15900590		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19470724, 21488187, 21761201, 22362714, 23874748, 24386390, 25408372, 30327455, 9515786, 9631067		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	12931023		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	18609681, 29221213		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	28412732		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24038948, 30651720		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11162602, 16984381, 26512878, 29448242		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22579115		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30069972		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16024624, 23114687, 24349376, 24860838, 31801961		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19610058, 20334896, 25743799, 30349301, 30518842, 31527303		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30355928, 30414902, 31828101		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11069302, 16760651, 18671143, 19113992, 19769738, 21057540, 24817950, 26548724, 27626412, 28402920, 29221213, 30069972, 9030252, 9450525		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	20661218, 31605132		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18671143, 22574716		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11779217		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23874748		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	15900590		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	18593994		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	18593994, 29984917, 30678435, 31541075	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	31541075		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11253137, 27468725	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31123173, 31696058		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	22137483		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	36773602	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19218339	Stimulate	★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	11593014, 24026482	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	27031247	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23522059, 26724804, 35536760, 39873160	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24319254		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20607722, 29285984		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30700698, 34064109	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37480569, 37861550	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11696596, 11875718, 12009577, 12173052, 16458113, 16984381, 17341467, 19113992, 19451093, 19769738, 22137483, 22329896, 22348039, 22412883, 24817950, 24971465, 25808857, 25849598, 25982682, 26029996, 26125663, 27167340, 28514905, 29795334, 29970521, 30327455, 30481564, 31157164, 31199987, 31527303, 31715364, 31746372, 31801961		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23892435, 26029996	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26029996		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	14760118, 19614764, 22965008, 26349989, 31746372, 31814919		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36471753	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24565852, 25479727, 27314445, 30142914		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27314445, 30142914, 32665038, 35056691	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22579115		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31010415, 32886452, 33710778, 34253236, 39710372	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34794761	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30069972		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29483831, 33099937	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	28601573		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	26125663	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	21411543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	21411543, 38537477	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	16024624, 23114687, 24349376, 24860838, 31801961		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10854060, 16762917, 24079846, 24574517, 24860838, 29233929, 31801961, 32243390, 33630978, 34497666, 36601001, 36834602, 37464317, 38179769	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17513602		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29239787		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	33416099, 36497125	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17668170		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21304051, 24800640		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	27090785		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	24141897, 27647547		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	33217867	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	31870357	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23217276		★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	27090785, 39259097	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	33495511	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34825846	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	11809526, 18048386		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21965721, 25849598		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23114644, 24817950		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	11696596, 20881335, 21965721, 26409447, 26912061, 29785357, 36768994, 37452322, 37480569	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23722120	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	29464035		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	25849598		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19610058, 20334896, 25743799, 30349301, 30518842, 31527303		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12200597	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17722244, 20037601, 21777278, 23079843, 24222951, 25124639, 25743799, 26211905, 27983933, 30569111, 30773850, 31387191, 33446695, 34126961, 38581717	Associate	★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	23114687		★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	BEFREE	26404029		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	24488334	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26706989, 35838025	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	30213925, 31183379	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	28730778	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	28548944		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25953261, 34797837, 35056723, 35846880, 38639528	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27986611, 28529455		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	10854060	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29246203, 30170380, 30355928, 31828101, 33000254, 36529823, 39456780	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33217824	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	12610511	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21338529, 30853662, 31337953, 35409328	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26738866	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	18353325, 35303800	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	37592341	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

DEUP1 2 shared diseasesNon-small-cell lung carcinoma, Polycystic ovary syndrome 1 shared evidence sourceCTD (Non-small-cell lung carcinoma) Related via 2 shared diseases including Non-small-cell lung carcinoma, Polycystic ovary syndrome — evidence mostly CTD. AKR1C1 2 shared diseasesNon-small-cell lung carcinoma, Polycystic ovary syndrome 3 shared evidence sourcesCTD (Non-small-cell lung carcinoma), CTD (Polycystic ovary syndrome), Disgenet (Polycystic ovary syndrome) Related via 2 shared diseases including Non-small-cell lung carcinoma, Polycystic ovary syndrome — evidence mostly CTD. ARHGAP30 1 shared diseasePolycystic ovary syndrome 2 shared evidence sourcesCTD (Polycystic ovary syndrome), Disgenet (Polycystic ovary syndrome) Related via 1 shared disease including Polycystic ovary syndrome — evidence mostly CTD. CARMIL3 1 shared diseasePolycystic ovary syndrome 2 shared evidence sourcesCTD (Polycystic ovary syndrome), Disgenet (Polycystic ovary syndrome) Related via 1 shared disease including Polycystic ovary syndrome — evidence mostly CTD. DACT3 1 shared diseasePolycystic ovary syndrome 2 shared evidence sourcesCTD (Polycystic ovary syndrome), Disgenet (Polycystic ovary syndrome) Related via 1 shared disease including Polycystic ovary syndrome — evidence mostly CTD.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
DEUP1	2	["Non-small-cell lung carcinoma","Polycystic ovary syndrome"]	0	[]	1	["CTD (Non-small-cell lung carcinoma)"]
AKR1C1	2	["Non-small-cell lung carcinoma","Polycystic ovary syndrome"]	0	[]	3	["CTD (Non-small-cell lung carcinoma)","CTD (Polycystic ovary syndrome)","Disgenet (Polycystic ovary syndrome)"]
ARHGAP30	1	["Polycystic ovary syndrome"]	0	[]	2	["CTD (Polycystic ovary syndrome)","Disgenet (Polycystic ovary syndrome)"]
CARMIL3	1	["Polycystic ovary syndrome"]	0	[]	2	["CTD (Polycystic ovary syndrome)","Disgenet (Polycystic ovary syndrome)"]
DACT3	1	["Polycystic ovary syndrome"]	0	[]	2	["CTD (Polycystic ovary syndrome)","Disgenet (Polycystic ovary syndrome)"]

Diseases Linked via Similar Genes

Glioblastoma Linked via 1 of 5 related genesDEUP1 Obesity Linked via 1 of 5 related genesDEUP1 Polycystic kidney disease Linked via 1 of 5 related genesDEUP1 Diabetes mellitus type 2 Linked via 1 of 5 related genesDEUP1 Disorders of sex development Linked via 1 of 5 related genesAKR1C1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Glioblastoma	1	["DEUP1"]
Obesity	1	["DEUP1"]
Polycystic kidney disease	1	["DEUP1"]
Diabetes mellitus type 2	1	["DEUP1"]
Disorders of sex development	1	["AKR1C1"]