Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	114800
Gene name	Coiled-coil domain containing 85A
Gene symbol	CCDC85A
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2p16.1

48 Show/Hide all (48)

miRTarBase ID	miRNA	Experiments
MIRT869928	hsa-miR-128	CLIP-seq
MIRT869929	hsa-miR-1976	CLIP-seq
MIRT869930	hsa-miR-205	CLIP-seq
MIRT869931	hsa-miR-27a	CLIP-seq
MIRT869932	hsa-miR-27b	CLIP-seq
MIRT869933	hsa-miR-3074-3p	CLIP-seq
MIRT869934	hsa-miR-3175	CLIP-seq
MIRT869935	hsa-miR-3184	CLIP-seq
MIRT869936	hsa-miR-382	CLIP-seq
MIRT869937	hsa-miR-423-5p	CLIP-seq
MIRT869938	hsa-miR-4434	CLIP-seq
MIRT869939	hsa-miR-4516	CLIP-seq
MIRT869940	hsa-miR-4695-3p	CLIP-seq
MIRT869941	hsa-miR-495	CLIP-seq
MIRT869942	hsa-miR-513a-5p	CLIP-seq
MIRT1958128	hsa-miR-219-2-3p	CLIP-seq
MIRT1958129	hsa-miR-3190	CLIP-seq
MIRT1958130	hsa-miR-33a	CLIP-seq
MIRT1958131	hsa-miR-33b	CLIP-seq
MIRT1958132	hsa-miR-4261	CLIP-seq
MIRT1958133	hsa-miR-4464	CLIP-seq
MIRT1958134	hsa-miR-4646-5p	CLIP-seq
MIRT1958135	hsa-miR-4748	CLIP-seq
MIRT1958136	hsa-miR-4752	CLIP-seq
MIRT1958137	hsa-miR-548a-3p	CLIP-seq
MIRT1958138	hsa-miR-548e	CLIP-seq
MIRT1958139	hsa-miR-548f	CLIP-seq
MIRT2195078	hsa-miR-34c-3p	CLIP-seq
MIRT2446428	hsa-miR-3124-3p	CLIP-seq
MIRT2446429	hsa-miR-3143	CLIP-seq
MIRT2446430	hsa-miR-3685	CLIP-seq
MIRT2446431	hsa-miR-384	CLIP-seq
MIRT2446432	hsa-miR-410	CLIP-seq
MIRT2446433	hsa-miR-4300	CLIP-seq
MIRT2446434	hsa-miR-4496	CLIP-seq
MIRT2446435	hsa-miR-543	CLIP-seq
MIRT2446436	hsa-miR-920	CLIP-seq
MIRT2446437	hsa-miR-939	CLIP-seq
MIRT2446428	hsa-miR-3124-3p	CLIP-seq
MIRT2446430	hsa-miR-3685	CLIP-seq
MIRT2446431	hsa-miR-384	CLIP-seq
MIRT2446434	hsa-miR-4496	CLIP-seq
MIRT2498412	hsa-miR-1323	CLIP-seq
MIRT2498413	hsa-miR-508-5p	CLIP-seq
MIRT2498414	hsa-miR-548o	CLIP-seq
MIRT2498412	hsa-miR-1323	CLIP-seq
MIRT2498413	hsa-miR-508-5p	CLIP-seq
MIRT2498414	hsa-miR-548o	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005912	Component	Adherens junction	IDA	25009281
GO:0005912	Component	Adherens junction	IEA
GO:0070161	Component	Anchoring junction	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q96PX6

Protein name

Coiled-coil domain-containing protein 85A

Protein function

May play a role in cell-cell adhesion and epithelium development through its interaction with proteins of the beta-catenin family.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10226	CCDC85	33 → 224	CCDC85 family	Family

Sequence

MSKAAGGAAAAAAAAESCSPAPAGSSAAPPAPVEDLSKVSDEELLQWSKEELIRSLRRAE
AEKVSAMLDHSNLIREVNRRLQLHLGEIRGLKDINQKLQEDNQELRDLCCFLDDDRQKGK
RVSREWQRLGRYTAGVMHKEVALYLQKLKDLEVKQEEVVKENMELKELCVLLDEEKGAGC
AGSRCSIDSQASLCQLTASTAPYVRDVGDGSSTSSTGSTDSPDHHKHHASSGSPEHLQKP
RSEGSPEHSKHRSASPEHPQKPRACGTPDRPKALKGPSPEHHKPLCKGSPEQQRHPHPGS
SPETLPKHVLSGSPEHFQKHRSGSSPEHARHSGGSPEHLQKHALGGSLEHLPRARGTSPE
HLKQHYGGSPDHKHGGGSGGSGGSGGGSREGTLRRQAQEDGSPHHRNVYSGMNESTLSYV
RQLEARVRQLEEENRMLPQASQNRRQPPTRNSSNMEKGWGSRARRVLQWWQGCRGIGRCL
PTLPGSFRLSSGADGSNSSPNSAASFSGHATPSQQPEPVVHSLKVVWRKLGDAAGSCPGI
RQHLSGNQYKGPM

Sequence length

553

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (11)
AUTOIMMUNE THROMBOCYTOPENIC PURPURA	—	GWAS catalog	39189922	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	29228715	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	31488892	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	31488892	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASM	—	GWAS catalog	31488892	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	35322040	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	38014556	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	35396580	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	33667223	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	30822522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30822522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30822522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	39344312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CCDC85A (coiled-coil domain containing 85A)

Save This Analysis