CAPNS2 (calpain small subunit 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 84290
Gene name Calpain small subunit 2
Gene symbol CAPNS2
Synonyms (NCBI Gene)
CSS2
Chromosome 16
Chromosome location 16q12.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004198 Function Calcium-dependent cysteine-type endopeptidase activity IDA 17646163
GO:0004198 Function Calcium-dependent cysteine-type endopeptidase activity IEA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616767 16371 ENSG00000256812
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96L46
Protein name Calpain small subunit 2 (CSS2) (Calcium-dependent protease small subunit 2)
Protein function Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. This small subunit may act as a tissue-specific chaperone of the large subunit, possibl
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13833 EF-hand_8 91 → 150 EF-hand domain pair Domain
Sequence 
MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEP
PPTQQHFTSVEASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFS
LDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQA
AGFQLNEQLYQMIVRRYANEDGDMDFNNFISCLVRLDAMFRAFKSLDRDRDGLIQVSIKE
WLQLTMYS
Sequence length 248
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Degradation of the extracellular matrix
Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models
Sort by:
CAST 2 shared pathwaysDeregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models, Degradation of the extracellular matrix Related via 2 shared pathways including Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models, Degradation of the extracellular matrix. CAPNS1 2 shared pathwaysDeregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models, Degradation of the extracellular matrix Related via 2 shared pathways including Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models, Degradation of the extracellular matrix. CAPN1 2 shared pathwaysDeregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models, Degradation of the extracellular matrix Related via 2 shared pathways including Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models, Degradation of the extracellular matrix. CAPN2 2 shared pathwaysDeregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models, Degradation of the extracellular matrix Related via 2 shared pathways including Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models, Degradation of the extracellular matrix.
Schizophrenia Linked via 2 of 4 related genesCAST, CAPN2 Aneurysm Linked via 1 of 4 related genesCAST Aortic aneurysm Linked via 1 of 4 related genesCAST Attention deficit hyperactivity disorder Linked via 1 of 4 related genesCAST Blood coagulation disorder Linked via 1 of 4 related genesCAST