Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	50632
Gene name	Calcyon neuron specific vesicular protein
Gene symbol	CALY
Synonyms (NCBI Gene)	DRD1IPNSG3
Chromosome	10
Chromosome location	10q26.3
Summary	The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopami

12 Show/Hide all (12)

miRTarBase ID	miRNA	Experiments
MIRT860007	hsa-miR-3135b	CLIP-seq
MIRT860008	hsa-miR-3652	CLIP-seq
MIRT860009	hsa-miR-4430	CLIP-seq
MIRT860010	hsa-miR-4492	CLIP-seq
MIRT860011	hsa-miR-4498	CLIP-seq
MIRT860012	hsa-miR-4508	CLIP-seq
MIRT860013	hsa-miR-4706	CLIP-seq
MIRT860014	hsa-miR-4734	CLIP-seq
MIRT860015	hsa-miR-4749-5p	CLIP-seq
MIRT860016	hsa-miR-604	CLIP-seq
MIRT860017	hsa-miR-744	CLIP-seq
MIRT860018	hsa-miR-762	CLIP-seq

22 Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16595675
GO:0005768	Component	Endosome	IBA
GO:0005886	Component	Plasma membrane	IDA	14534309
GO:0005886	Component	Plasma membrane	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016197	Process	Endosomal transport	IBA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	14534309, 16595675
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032051	Function	Clathrin light chain binding	IBA
GO:0032051	Function	Clathrin light chain binding	IDA	16595675
GO:0032051	Function	Clathrin light chain binding	IEA
GO:0045807	Process	Positive regulation of endocytosis	IMP	16595675
GO:0048268	Process	Clathrin coat assembly	IBA
GO:0048268	Process	Clathrin coat assembly	IDA	16595675
GO:0048268	Process	Clathrin coat assembly	IEA
GO:0098843	Component	Postsynaptic endocytic zone	IDA	16595675
GO:0098843	Component	Postsynaptic endocytic zone	IMP	16595675
GO:0098884	Process	Postsynaptic neurotransmitter receptor internalization	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

MIM	HGNC	e!Ensembl
604647	17938	ENSG00000130643

Q9NYX4

Protein name

Neuron-specific vesicular protein calcyon

Protein function

Interacts with clathrin light chain A and stimulates clathrin self-assembly and clathrin-mediated endocytosis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06387	Calcyon	1 → 181	D1 dopamine receptor-interacting protein (calcyon)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the pyramidal cells of the prefrontal cortex, in hypothalamus and in caudate nucleus. No expression in spleen. Up-regulated in the prefrontal cortex of schizophrenic patients with nearly twice the levels of non-schizophren

Sequence

MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPD
QQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLR
HKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPT
QAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ

Sequence length

217

Interactions

View interactions

KEGG Pathway
Dopaminergic synapse

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER WITH HYPERACTIVITY	—	CTD	30753204	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	30753204	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	30753204	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (12)
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	30753204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	18670637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG	30753204		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	16172615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG	30753204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	31279243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	CTD_human_DG	30753204		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	BEFREE	27113058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	30753204		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Minimal Brain Dysfunction	Minimal Brain Dysfunction	CTD_human_DG	30753204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	14755439, 15364041		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	15364041		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

CALY (calcyon neuron specific vesicular protein)

Save This Analysis