Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	810
Gene name	Calmodulin like 3
Gene symbol	CALML3
Synonyms (NCBI Gene)	CLP
Chromosome	10
Chromosome location	10p15.1

106 Show/Hide all (106)

miRTarBase ID	miRNA	Experiments	Reference
MIRT489727	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT489725	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT489726	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT489724	hsa-miR-940	PAR-CLIP	23592263
MIRT489723	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT489722	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT489721	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT489720	hsa-miR-6087	PAR-CLIP	23592263
MIRT489719	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT489718	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT489717	hsa-miR-765	PAR-CLIP	23592263
MIRT489716	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT489715	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT489714	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT489713	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT489712	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT489710	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT489711	hsa-miR-5698	PAR-CLIP	23592263
MIRT489709	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT489708	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT489707	hsa-miR-4525	PAR-CLIP	23592263
MIRT489706	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT489705	hsa-miR-1275	PAR-CLIP	23592263
MIRT489704	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT489727	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT489725	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT489726	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT489724	hsa-miR-940	PAR-CLIP	23592263
MIRT489723	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT489722	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT489721	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT489720	hsa-miR-6087	PAR-CLIP	23592263
MIRT489719	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT489718	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT489717	hsa-miR-765	PAR-CLIP	23592263
MIRT489716	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT489715	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT489714	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT489713	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT489712	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT489710	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT489711	hsa-miR-5698	PAR-CLIP	23592263
MIRT489709	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT489708	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT489707	hsa-miR-4525	PAR-CLIP	23592263
MIRT489706	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT489705	hsa-miR-1275	PAR-CLIP	23592263
MIRT489704	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT859531	hsa-miR-1253	CLIP-seq
MIRT859532	hsa-miR-139-3p	CLIP-seq
MIRT859533	hsa-miR-145	CLIP-seq
MIRT859534	hsa-miR-2115	CLIP-seq
MIRT859535	hsa-miR-2467-3p	CLIP-seq
MIRT859536	hsa-miR-3665	CLIP-seq
MIRT859537	hsa-miR-3678-3p	CLIP-seq
MIRT859538	hsa-miR-3919	CLIP-seq
MIRT859539	hsa-miR-4300	CLIP-seq
MIRT859540	hsa-miR-4419a	CLIP-seq
MIRT859541	hsa-miR-4433	CLIP-seq
MIRT859542	hsa-miR-4510	CLIP-seq
MIRT859543	hsa-miR-455-3p	CLIP-seq
MIRT859544	hsa-miR-4722-5p	CLIP-seq
MIRT859545	hsa-miR-4734	CLIP-seq
MIRT859546	hsa-miR-4747-5p	CLIP-seq
MIRT859547	hsa-miR-493	CLIP-seq
MIRT859548	hsa-miR-596	CLIP-seq
MIRT859549	hsa-miR-625	CLIP-seq
MIRT859550	hsa-miR-665	CLIP-seq
MIRT859551	hsa-miR-920	CLIP-seq
MIRT859533	hsa-miR-145	CLIP-seq
MIRT859534	hsa-miR-2115	CLIP-seq
MIRT859539	hsa-miR-4300	CLIP-seq
MIRT859540	hsa-miR-4419a	CLIP-seq
MIRT859542	hsa-miR-4510	CLIP-seq
MIRT859543	hsa-miR-455-3p	CLIP-seq
MIRT859548	hsa-miR-596	CLIP-seq
MIRT859550	hsa-miR-665	CLIP-seq
MIRT859551	hsa-miR-920	CLIP-seq
MIRT859533	hsa-miR-145	CLIP-seq
MIRT859534	hsa-miR-2115	CLIP-seq
MIRT859539	hsa-miR-4300	CLIP-seq
MIRT859540	hsa-miR-4419a	CLIP-seq
MIRT859542	hsa-miR-4510	CLIP-seq
MIRT859543	hsa-miR-455-3p	CLIP-seq
MIRT859548	hsa-miR-596	CLIP-seq
MIRT859550	hsa-miR-665	CLIP-seq
MIRT859551	hsa-miR-920	CLIP-seq
MIRT859533	hsa-miR-145	CLIP-seq
MIRT859534	hsa-miR-2115	CLIP-seq
MIRT859539	hsa-miR-4300	CLIP-seq
MIRT859540	hsa-miR-4419a	CLIP-seq
MIRT859542	hsa-miR-4510	CLIP-seq
MIRT859543	hsa-miR-455-3p	CLIP-seq
MIRT859548	hsa-miR-596	CLIP-seq
MIRT859550	hsa-miR-665	CLIP-seq
MIRT859551	hsa-miR-920	CLIP-seq
MIRT2446095	hsa-miR-1827	CLIP-seq
MIRT2446096	hsa-miR-1909	CLIP-seq
MIRT2446097	hsa-miR-3612	CLIP-seq
MIRT859549	hsa-miR-625	CLIP-seq
MIRT2446098	hsa-miR-650	CLIP-seq
MIRT2446095	hsa-miR-1827	CLIP-seq
MIRT2446096	hsa-miR-1909	CLIP-seq
MIRT2446097	hsa-miR-3612	CLIP-seq
MIRT859549	hsa-miR-625	CLIP-seq
MIRT2446098	hsa-miR-650	CLIP-seq

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	8428750
GO:0005513	Process	Detection of calcium ion	IBA
GO:0005515	Function	Protein binding	IPI	16189514, 18570893, 21044950, 25416956, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0010880	Process	Regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IBA
GO:0030672	Component	Synaptic vesicle membrane	IBA
GO:0043209	Component	Myelin sheath	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0097720	Process	Calcineurin-mediated signaling	IBA

MIM	HGNC	e!Ensembl
114184	1452	ENSG00000178363

P27482

Protein name

Calmodulin-like protein 3 (CaM-like protein) (CLP) (Calmodulin-related protein NB-1)

Protein function

May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different aff

PDB

1GGZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00036	EF-hand_1	85 → 113	EF hand	Domain
PF00036	EF-hand_1	12 → 40	EF hand	Domain
PF00036	EF-hand_1	121 → 149	EF hand	Domain
PF00036	EF-hand_1	48 → 76	EF hand	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells. {ECO:0000269|PubMed:2217169}.

Sequence

MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDG
NGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDE
EVDEMIRAADTDGDGQVNYEEFVRVLVSK

Sequence length

149

Interactions

View interactions

KEGG Pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Cellular senescence
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Apelin signaling pathway
C-type lectin receptor signaling pathway
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Dopaminergic synapse
Olfactory transduction
Phototransduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Aldosterone synthesis and secretion
Salivary secretion
Gastric acid secretion
Alzheimer disease
Parkinson disease
Pathways of neurodegeneration - multiple diseases
Amphetamine addiction
Alcoholism
Pertussis
Tuberculosis
Human cytomegalovirus infection
Kaposi sarcoma-associated herpesvirus infection
Human immunodeficiency virus 1 infection
Pathways in cancer
Glioma
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LUNG NEOPLASMS	—	CTD	27935865	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (32)
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27696572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28925397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23638045	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32280695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37442189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Soft Palate	Cleft Soft Palate	BEFREE	28393073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28437455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17786325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental absence of tooth	Anodontia	BEFREE	22612415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36807337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30269613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	BEFREE	21248356, 22612415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29445139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	27935865		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	31231966		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	28925397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29445139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	27935865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28925397, 29338031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17786325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	BEFREE	29460382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral cleft	Oral cleft	BEFREE	11754469, 31226652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17786325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pierre Robin Syndrome	Pierre-Robin Syndrome	BEFREE	29125932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25559266, 25981615, 28167245, 28246552, 28715505, 28910403, 29095202, 29338031, 29500815, 29535830, 29914696, 29937001, 30690081, 30918470, 30961427, 31049763, 31223614, 31231384 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	23638045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Submucous cleft palate	Submucosal cleft palate	BEFREE	24437586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35351042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31669320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	15516164, 29742363, 31226652, 31795734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31298313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31298313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
CALML6	[]	39	["Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","cGMP-PKG signaling pathway","cAMP signaling pathway","Phosphatidylinositol signaling system","Oocyte meiosis","Cellular senescence","Adrenergic signaling in cardiomyocytes","Vascular smooth muscle contraction","Apelin signaling pathway","C-type lectin receptor signaling pathway"]	[]
CALML5	[]	39	["Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","cGMP-PKG signaling pathway","cAMP signaling pathway","Phosphatidylinositol signaling system","Oocyte meiosis","Cellular senescence","Adrenergic signaling in cardiomyocytes","Vascular smooth muscle contraction","Apelin signaling pathway","C-type lectin receptor signaling pathway"]	[]
CALML4	[]	39	["Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","cGMP-PKG signaling pathway","cAMP signaling pathway","Phosphatidylinositol signaling system","Oocyte meiosis","Cellular senescence","Adrenergic signaling in cardiomyocytes","Vascular smooth muscle contraction","Apelin signaling pathway","C-type lectin receptor signaling pathway"]	[]
CALM1	[]	39	["Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","cGMP-PKG signaling pathway","cAMP signaling pathway","Phosphatidylinositol signaling system","Oocyte meiosis","Cellular senescence","Adrenergic signaling in cardiomyocytes","Vascular smooth muscle contraction","Apelin signaling pathway","C-type lectin receptor signaling pathway"]	[]
CALM2	[]	39	["Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","cGMP-PKG signaling pathway","cAMP signaling pathway","Phosphatidylinositol signaling system","Oocyte meiosis","Cellular senescence","Adrenergic signaling in cardiomyocytes","Vascular smooth muscle contraction","Apelin signaling pathway","C-type lectin receptor signaling pathway"]	[]

CALML3 (calmodulin like 3)

Save This Analysis