Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	733
Gene name	Complement C8 gamma chain
Gene symbol	C8G
Synonyms (NCBI Gene)	C8C
Chromosome	9
Chromosome location	9q34.3
Summary	The protein encoded by this gene belongs to the lipocalin family. It is one of the three subunits that constitutes complement component 8 (C8), which is composed of a disulfide-linked C8 alpha-gamma heterodimer and a non-covalently associated C8 beta chai

8 Show/Hide all (8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017056	hsa-miR-335-5p	Microarray	18185580
MIRT852923	hsa-miR-326	CLIP-seq
MIRT852924	hsa-miR-330-5p	CLIP-seq
MIRT852925	hsa-miR-3909	CLIP-seq
MIRT852926	hsa-miR-4667-5p	CLIP-seq
MIRT852927	hsa-miR-4700-5p	CLIP-seq
MIRT852928	hsa-miR-486-3p	CLIP-seq
MIRT852929	hsa-miR-637	CLIP-seq

23 Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005579	Component	Membrane attack complex	IDA	26841837, 27052168, 30552328, 30643019, 31061395, 36797260
GO:0005579	Component	Membrane attack complex	IEA
GO:0005579	Component	Membrane attack complex	IPI	30552328
GO:0005886	Component	Plasma membrane	NAS	30552328
GO:0006956	Process	Complement activation	IDA	26841837, 27052168
GO:0006956	Process	Complement activation	IEA
GO:0006957	Process	Complement activation, alternative pathway	IEA
GO:0006958	Process	Complement activation, classical pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0019841	Function	Retinol binding	IEA
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0044218	Component	Other organism cell membrane	IDA	27052168
GO:0044218	Component	Other organism cell membrane	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0050778	Process	Positive regulation of immune response	NAS	30552328
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0160257	Process	Complement activation, GZMK pathway	IDA	39914456
GO:1902495	Component	Transmembrane transporter complex	IDA	30552328

MIM	HGNC	e!Ensembl
120930	1354	ENSG00000176919

P07360

Protein name

Complement component C8 gamma chain

Protein function

Component of the membrane attack complex (MAC), a multiprotein complex activated by the complement cascade, which inserts into a target cell membrane and forms a pore, leading to target cell membrane rupture and cell lysis (PubMed:26841837, PubM

PDB

1IW2 , 1LF7 , 2OVA , 2OVD , 2OVE , 2QOS , 2RD7 , 3OJY , 6H03 , 6H04 , 7NYC , 7NYD , 8B0F , 8B0G , 8B0H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	48 → 186	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Sequence

MLPPGTATLLTLLLAAGSLGQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSAC
RFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDAR
GAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIF
YFPKYGFCEAADQFHVLDEVRR

Sequence length

202

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Complement and coagulation cascades	Terminal pathway of complement
Regulation of actin cytoskeleton	Regulation of Complement cascade
Prion disease
Amoebiasis
Coronavirus disease - COVID-19
Systemic lupus erythematosus

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (8)
Acute myeloid leukemia	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
C8G-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunodeficiency	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TERMINAL COMPONENT DEFICIENCY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (7)
Atrophy	Atrophy	Pubtator	37020564	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39199284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement deficiency disease	Complement Component Deficiency	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	37020564	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	37020564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunodeficiency due to a late component of complement deficiency	Immunodeficiency	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36420131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
C8A	1	["Terminal complement component deficiency"]	8	["Complement and coagulation cascades","Regulation of actin cytoskeleton","Prion disease","Amoebiasis","Coronavirus disease - COVID-19","Systemic lupus erythematosus","Regulation of Complement cascade","Terminal pathway of complement"]	1	["Disgenet (Terminal complement component deficiency)"]
C8B	1	["Terminal complement component deficiency"]	8	["Complement and coagulation cascades","Regulation of actin cytoskeleton","Prion disease","Amoebiasis","Coronavirus disease - COVID-19","Systemic lupus erythematosus","Regulation of Complement cascade","Terminal pathway of complement"]	1	["Disgenet (Terminal complement component deficiency)"]
C9	1	["Terminal complement component deficiency"]	8	["Complement and coagulation cascades","Regulation of actin cytoskeleton","Prion disease","Amoebiasis","Coronavirus disease - COVID-19","Systemic lupus erythematosus","Regulation of Complement cascade","Terminal pathway of complement"]	1	["Disgenet (Terminal complement component deficiency)"]
C6	1	["Terminal complement component deficiency"]	7	["Complement and coagulation cascades","Regulation of actin cytoskeleton","Prion disease","Coronavirus disease - COVID-19","Systemic lupus erythematosus","Regulation of Complement cascade","Terminal pathway of complement"]	1	["Disgenet (Terminal complement component deficiency)"]
C7	1	["Terminal complement component deficiency"]	7	["Complement and coagulation cascades","Regulation of actin cytoskeleton","Prion disease","Coronavirus disease - COVID-19","Systemic lupus erythematosus","Regulation of Complement cascade","Terminal pathway of complement"]	1	["Disgenet (Terminal complement component deficiency)"]

C8G (complement C8 gamma chain)

Save This Analysis