Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	730
Gene name	Complement C7
Gene symbol	C7
Synonyms (NCBI Gene)	-
Chromosome	5
Chromosome location	5p13.1
Summary	This gene encodes a serum glycoprotein that forms a membrane attack complex together with complement components C5b, C6, C8, and C9 as part of the terminal complement pathway of the innate immune system. The protein encoded by this gene contains a cholest

11 Show/Hide all (11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121964920	C>A,T	Pathogenic	Coding sequence variant, missense variant
rs121964921	G>A,C,T	Pathogenic	Coding sequence variant, missense variant
rs121964922	T>A	Pathogenic	Stop gained, coding sequence variant
rs139491301	T>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs201240159	T>C	Pathogenic	Splice donor variant
rs387906509	T>A	Pathogenic	Coding sequence variant, stop gained
rs531103546	G>T	Pathogenic	Splice acceptor variant
rs764871530	AG>-	Pathogenic	Coding sequence variant, frameshift variant
rs779723422	G>-	Pathogenic	Coding sequence variant, splice donor variant
rs1064794728	GTA>TT	Likely-pathogenic	Splice acceptor variant, intron variant
rs1579848888	A>-	Pathogenic	Frameshift variant, coding sequence variant

258 Show/Hide all (258)

miRTarBase ID	miRNA	Experiments
MIRT852027	hsa-miR-1206	CLIP-seq
MIRT852028	hsa-miR-1253	CLIP-seq
MIRT852029	hsa-miR-1268	CLIP-seq
MIRT852030	hsa-miR-1268b	CLIP-seq
MIRT852031	hsa-miR-1285	CLIP-seq
MIRT852032	hsa-miR-1297	CLIP-seq
MIRT852033	hsa-miR-1908	CLIP-seq
MIRT852034	hsa-miR-2116	CLIP-seq
MIRT852035	hsa-miR-26a	CLIP-seq
MIRT852036	hsa-miR-26b	CLIP-seq
MIRT852037	hsa-miR-3065-5p	CLIP-seq
MIRT852038	hsa-miR-3122	CLIP-seq
MIRT852039	hsa-miR-3133	CLIP-seq
MIRT852040	hsa-miR-3185	CLIP-seq
MIRT852041	hsa-miR-3187-5p	CLIP-seq
MIRT852042	hsa-miR-323-5p	CLIP-seq
MIRT852043	hsa-miR-3529	CLIP-seq
MIRT852044	hsa-miR-3609	CLIP-seq
MIRT852045	hsa-miR-3672	CLIP-seq
MIRT852046	hsa-miR-3675-3p	CLIP-seq
MIRT852047	hsa-miR-3689a-3p	CLIP-seq
MIRT852048	hsa-miR-3689c	CLIP-seq
MIRT852049	hsa-miR-3714	CLIP-seq
MIRT852050	hsa-miR-375	CLIP-seq
MIRT852051	hsa-miR-379	CLIP-seq
MIRT852052	hsa-miR-3909	CLIP-seq
MIRT852053	hsa-miR-3913-5p	CLIP-seq
MIRT852054	hsa-miR-3927	CLIP-seq
MIRT852055	hsa-miR-3937	CLIP-seq
MIRT852056	hsa-miR-4286	CLIP-seq
MIRT852057	hsa-miR-4434	CLIP-seq
MIRT852058	hsa-miR-4465	CLIP-seq
MIRT852059	hsa-miR-4476	CLIP-seq
MIRT852060	hsa-miR-4486	CLIP-seq
MIRT852061	hsa-miR-4516	CLIP-seq
MIRT852062	hsa-miR-4522	CLIP-seq
MIRT852063	hsa-miR-4531	CLIP-seq
MIRT852064	hsa-miR-4677-5p	CLIP-seq
MIRT852065	hsa-miR-4684-5p	CLIP-seq
MIRT852066	hsa-miR-4728-5p	CLIP-seq
MIRT852067	hsa-miR-4755-3p	CLIP-seq
MIRT852068	hsa-miR-4773	CLIP-seq
MIRT852069	hsa-miR-520g	CLIP-seq
MIRT852070	hsa-miR-520h	CLIP-seq
MIRT852071	hsa-miR-548ah	CLIP-seq
MIRT852072	hsa-miR-548c-3p	CLIP-seq
MIRT852073	hsa-miR-585	CLIP-seq
MIRT852074	hsa-miR-607	CLIP-seq
MIRT852075	hsa-miR-612	CLIP-seq
MIRT852076	hsa-miR-616	CLIP-seq
MIRT852077	hsa-miR-654-3p	CLIP-seq
MIRT852078	hsa-miR-661	CLIP-seq
MIRT852079	hsa-miR-663	CLIP-seq
MIRT852080	hsa-miR-665	CLIP-seq
MIRT852081	hsa-miR-766	CLIP-seq
MIRT852082	hsa-miR-876-3p	CLIP-seq
MIRT852083	hsa-miR-940	CLIP-seq
MIRT1952761	hsa-miR-1252	CLIP-seq
MIRT1952762	hsa-miR-1273g	CLIP-seq
MIRT852031	hsa-miR-1285	CLIP-seq
MIRT1952763	hsa-miR-140-3p	CLIP-seq
MIRT852037	hsa-miR-3065-5p	CLIP-seq
MIRT852038	hsa-miR-3122	CLIP-seq
MIRT852040	hsa-miR-3185	CLIP-seq
MIRT852041	hsa-miR-3187-5p	CLIP-seq
MIRT852042	hsa-miR-323-5p	CLIP-seq
MIRT852043	hsa-miR-3529	CLIP-seq
MIRT852044	hsa-miR-3609	CLIP-seq
MIRT852047	hsa-miR-3689a-3p	CLIP-seq
MIRT852048	hsa-miR-3689c	CLIP-seq
MIRT852049	hsa-miR-3714	CLIP-seq
MIRT852051	hsa-miR-379	CLIP-seq
MIRT852053	hsa-miR-3913-5p	CLIP-seq
MIRT852054	hsa-miR-3927	CLIP-seq
MIRT852055	hsa-miR-3937	CLIP-seq
MIRT852056	hsa-miR-4286	CLIP-seq
MIRT852059	hsa-miR-4476	CLIP-seq
MIRT852066	hsa-miR-4728-5p	CLIP-seq
MIRT852069	hsa-miR-520g	CLIP-seq
MIRT852070	hsa-miR-520h	CLIP-seq
MIRT852071	hsa-miR-548ah	CLIP-seq
MIRT1952764	hsa-miR-563	CLIP-seq
MIRT852075	hsa-miR-612	CLIP-seq
MIRT852078	hsa-miR-661	CLIP-seq
MIRT852081	hsa-miR-766	CLIP-seq
MIRT852082	hsa-miR-876-3p	CLIP-seq
MIRT852083	hsa-miR-940	CLIP-seq
MIRT852027	hsa-miR-1206	CLIP-seq
MIRT852031	hsa-miR-1285	CLIP-seq
MIRT852037	hsa-miR-3065-5p	CLIP-seq
MIRT852038	hsa-miR-3122	CLIP-seq
MIRT852041	hsa-miR-3187-5p	CLIP-seq
MIRT852042	hsa-miR-323-5p	CLIP-seq
MIRT2190543	hsa-miR-3607-3p	CLIP-seq
MIRT852044	hsa-miR-3609	CLIP-seq
MIRT852045	hsa-miR-3672	CLIP-seq
MIRT2190544	hsa-miR-3686	CLIP-seq
MIRT852047	hsa-miR-3689a-3p	CLIP-seq
MIRT852048	hsa-miR-3689c	CLIP-seq
MIRT852049	hsa-miR-3714	CLIP-seq
MIRT852053	hsa-miR-3913-5p	CLIP-seq
MIRT2190545	hsa-miR-3919	CLIP-seq
MIRT2190546	hsa-miR-3922-5p	CLIP-seq
MIRT852055	hsa-miR-3937	CLIP-seq
MIRT852056	hsa-miR-4286	CLIP-seq
MIRT2190547	hsa-miR-4307	CLIP-seq
MIRT852062	hsa-miR-4522	CLIP-seq
MIRT852066	hsa-miR-4728-5p	CLIP-seq
MIRT852069	hsa-miR-520g	CLIP-seq
MIRT852070	hsa-miR-520h	CLIP-seq
MIRT852071	hsa-miR-548ah	CLIP-seq
MIRT852075	hsa-miR-612	CLIP-seq
MIRT852077	hsa-miR-654-3p	CLIP-seq
MIRT852078	hsa-miR-661	CLIP-seq
MIRT852081	hsa-miR-766	CLIP-seq
MIRT852082	hsa-miR-876-3p	CLIP-seq
MIRT852083	hsa-miR-940	CLIP-seq
MIRT852027	hsa-miR-1206	CLIP-seq
MIRT852042	hsa-miR-323-5p	CLIP-seq
MIRT852067	hsa-miR-4755-3p	CLIP-seq
MIRT852077	hsa-miR-654-3p	CLIP-seq
MIRT852082	hsa-miR-876-3p	CLIP-seq
MIRT1952763	hsa-miR-140-3p	CLIP-seq
MIRT2445841	hsa-miR-1245b-5p	CLIP-seq
MIRT852029	hsa-miR-1268	CLIP-seq
MIRT852030	hsa-miR-1268b	CLIP-seq
MIRT852031	hsa-miR-1285	CLIP-seq
MIRT852033	hsa-miR-1908	CLIP-seq
MIRT852038	hsa-miR-3122	CLIP-seq
MIRT2445842	hsa-miR-3140-5p	CLIP-seq
MIRT2445843	hsa-miR-3142	CLIP-seq
MIRT852041	hsa-miR-3187-5p	CLIP-seq
MIRT2190543	hsa-miR-3607-3p	CLIP-seq
MIRT2445844	hsa-miR-3662	CLIP-seq
MIRT852046	hsa-miR-3675-3p	CLIP-seq
MIRT2190544	hsa-miR-3686	CLIP-seq
MIRT852047	hsa-miR-3689a-3p	CLIP-seq
MIRT852048	hsa-miR-3689c	CLIP-seq
MIRT852049	hsa-miR-3714	CLIP-seq
MIRT852053	hsa-miR-3913-5p	CLIP-seq
MIRT852055	hsa-miR-3937	CLIP-seq
MIRT852056	hsa-miR-4286	CLIP-seq
MIRT852060	hsa-miR-4486	CLIP-seq
MIRT852065	hsa-miR-4684-5p	CLIP-seq
MIRT852066	hsa-miR-4728-5p	CLIP-seq
MIRT2445845	hsa-miR-4790-3p	CLIP-seq
MIRT852072	hsa-miR-548c-3p	CLIP-seq
MIRT852073	hsa-miR-585	CLIP-seq
MIRT852075	hsa-miR-612	CLIP-seq
MIRT852077	hsa-miR-654-3p	CLIP-seq
MIRT852078	hsa-miR-661	CLIP-seq
MIRT852079	hsa-miR-663	CLIP-seq
MIRT852081	hsa-miR-766	CLIP-seq
MIRT852083	hsa-miR-940	CLIP-seq
MIRT852029	hsa-miR-1268	CLIP-seq
MIRT852030	hsa-miR-1268b	CLIP-seq
MIRT852038	hsa-miR-3122	CLIP-seq
MIRT2190543	hsa-miR-3607-3p	CLIP-seq
MIRT852046	hsa-miR-3675-3p	CLIP-seq
MIRT2190544	hsa-miR-3686	CLIP-seq
MIRT852047	hsa-miR-3689a-3p	CLIP-seq
MIRT852048	hsa-miR-3689c	CLIP-seq
MIRT852049	hsa-miR-3714	CLIP-seq
MIRT852053	hsa-miR-3913-5p	CLIP-seq
MIRT852055	hsa-miR-3937	CLIP-seq
MIRT852060	hsa-miR-4486	CLIP-seq
MIRT852065	hsa-miR-4684-5p	CLIP-seq
MIRT852066	hsa-miR-4728-5p	CLIP-seq
MIRT852072	hsa-miR-548c-3p	CLIP-seq
MIRT852073	hsa-miR-585	CLIP-seq
MIRT852077	hsa-miR-654-3p	CLIP-seq
MIRT852083	hsa-miR-940	CLIP-seq
MIRT852029	hsa-miR-1268	CLIP-seq
MIRT852030	hsa-miR-1268b	CLIP-seq
MIRT852031	hsa-miR-1285	CLIP-seq
MIRT1952763	hsa-miR-140-3p	CLIP-seq
MIRT852033	hsa-miR-1908	CLIP-seq
MIRT852037	hsa-miR-3065-5p	CLIP-seq
MIRT2494577	hsa-miR-3120-5p	CLIP-seq
MIRT852038	hsa-miR-3122	CLIP-seq
MIRT852041	hsa-miR-3187-5p	CLIP-seq
MIRT2190543	hsa-miR-3607-3p	CLIP-seq
MIRT852044	hsa-miR-3609	CLIP-seq
MIRT2494578	hsa-miR-3664-5p	CLIP-seq
MIRT852045	hsa-miR-3672	CLIP-seq
MIRT852046	hsa-miR-3675-3p	CLIP-seq
MIRT2190544	hsa-miR-3686	CLIP-seq
MIRT852047	hsa-miR-3689a-3p	CLIP-seq
MIRT852048	hsa-miR-3689c	CLIP-seq
MIRT852049	hsa-miR-3714	CLIP-seq
MIRT852053	hsa-miR-3913-5p	CLIP-seq
MIRT852055	hsa-miR-3937	CLIP-seq
MIRT852056	hsa-miR-4286	CLIP-seq
MIRT2494579	hsa-miR-4433	CLIP-seq
MIRT2494580	hsa-miR-4459	CLIP-seq
MIRT852060	hsa-miR-4486	CLIP-seq
MIRT852062	hsa-miR-4522	CLIP-seq
MIRT852065	hsa-miR-4684-5p	CLIP-seq
MIRT2494581	hsa-miR-4695-5p	CLIP-seq
MIRT852066	hsa-miR-4728-5p	CLIP-seq
MIRT2494582	hsa-miR-4768-3p	CLIP-seq
MIRT852069	hsa-miR-520g	CLIP-seq
MIRT852070	hsa-miR-520h	CLIP-seq
MIRT2494583	hsa-miR-544b	CLIP-seq
MIRT852071	hsa-miR-548ah	CLIP-seq
MIRT852072	hsa-miR-548c-3p	CLIP-seq
MIRT852073	hsa-miR-585	CLIP-seq
MIRT852075	hsa-miR-612	CLIP-seq
MIRT852077	hsa-miR-654-3p	CLIP-seq
MIRT852078	hsa-miR-661	CLIP-seq
MIRT852079	hsa-miR-663	CLIP-seq
MIRT852080	hsa-miR-665	CLIP-seq
MIRT852081	hsa-miR-766	CLIP-seq
MIRT852083	hsa-miR-940	CLIP-seq
MIRT2677085	hsa-miR-1179	CLIP-seq
MIRT2445841	hsa-miR-1245b-5p	CLIP-seq
MIRT852029	hsa-miR-1268	CLIP-seq
MIRT852030	hsa-miR-1268b	CLIP-seq
MIRT852031	hsa-miR-1285	CLIP-seq
MIRT1952763	hsa-miR-140-3p	CLIP-seq
MIRT2677086	hsa-miR-186	CLIP-seq
MIRT852033	hsa-miR-1908	CLIP-seq
MIRT852037	hsa-miR-3065-5p	CLIP-seq
MIRT852038	hsa-miR-3122	CLIP-seq
MIRT2445842	hsa-miR-3140-5p	CLIP-seq
MIRT2445843	hsa-miR-3142	CLIP-seq
MIRT852041	hsa-miR-3187-5p	CLIP-seq
MIRT2677087	hsa-miR-337-3p	CLIP-seq
MIRT2190543	hsa-miR-3607-3p	CLIP-seq
MIRT852044	hsa-miR-3609	CLIP-seq
MIRT2445844	hsa-miR-3662	CLIP-seq
MIRT852046	hsa-miR-3675-3p	CLIP-seq
MIRT2190544	hsa-miR-3686	CLIP-seq
MIRT852047	hsa-miR-3689a-3p	CLIP-seq
MIRT852048	hsa-miR-3689c	CLIP-seq
MIRT852049	hsa-miR-3714	CLIP-seq
MIRT852053	hsa-miR-3913-5p	CLIP-seq
MIRT852055	hsa-miR-3937	CLIP-seq
MIRT852056	hsa-miR-4286	CLIP-seq
MIRT2494579	hsa-miR-4433	CLIP-seq
MIRT2494580	hsa-miR-4459	CLIP-seq
MIRT852060	hsa-miR-4486	CLIP-seq
MIRT852065	hsa-miR-4684-5p	CLIP-seq
MIRT852066	hsa-miR-4728-5p	CLIP-seq
MIRT2494582	hsa-miR-4768-3p	CLIP-seq
MIRT2445845	hsa-miR-4790-3p	CLIP-seq
MIRT852069	hsa-miR-520g	CLIP-seq
MIRT852070	hsa-miR-520h	CLIP-seq
MIRT2494583	hsa-miR-544b	CLIP-seq
MIRT852071	hsa-miR-548ah	CLIP-seq
MIRT852072	hsa-miR-548c-3p	CLIP-seq
MIRT852073	hsa-miR-585	CLIP-seq
MIRT852075	hsa-miR-612	CLIP-seq
MIRT852077	hsa-miR-654-3p	CLIP-seq
MIRT852078	hsa-miR-661	CLIP-seq
MIRT852079	hsa-miR-663	CLIP-seq
MIRT852081	hsa-miR-766	CLIP-seq
MIRT852083	hsa-miR-940	CLIP-seq

25 Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005579	Component	Membrane attack complex	IBA
GO:0005579	Component	Membrane attack complex	IDA	22832194, 26841837, 27052168, 30552328, 30643019, 31061395, 32569291, 36797260
GO:0005579	Component	Membrane attack complex	IEA
GO:0005579	Component	Membrane attack complex	IPI	30552328
GO:0005579	Component	Membrane attack complex	TAS	3335508
GO:0005615	Component	Extracellular space	IBA
GO:0005886	Component	Plasma membrane	NAS	30552328
GO:0006955	Process	Immune response	IEA
GO:0006956	Process	Complement activation	IBA
GO:0006956	Process	Complement activation	IDA	26841837, 27052168, 32569291
GO:0006956	Process	Complement activation	TAS	3335508
GO:0006957	Process	Complement activation, alternative pathway	IEA
GO:0006958	Process	Complement activation, classical pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0044218	Component	Other organism cell membrane	IDA	27052168, 32569291
GO:0044218	Component	Other organism cell membrane	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0050778	Process	Positive regulation of immune response	NAS	30552328
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0160257	Process	Complement activation, GZMK pathway	IDA	39914456
GO:1902495	Component	Transmembrane transporter complex	IDA	30552328

MIM	HGNC	e!Ensembl
217070	1346	ENSG00000112936

P10643

Protein name

Complement component C7

Protein function

Component of the membrane attack complex (MAC), a multiprotein complex activated by the complement cascade, which inserts into a target cell membrane and forms a pore, leading to target cell membrane rupture and cell lysis (PubMed:22832194, PubM

PDB

2WCY , 6H03 , 6H04 , 7NYC , 7NYD , 8B0F , 8B0G , 8B0H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00057	Ldl_recept_a	83 → 119	Low-density lipoprotein receptor domain class A	Repeat
PF00084	Sushi	571 → 626	Sushi repeat (SCR repeat)	Domain
PF00084	Sushi	631 → 688	Sushi repeat (SCR repeat)	Domain
PF01823	MACPF	227 → 448	MAC/Perforin domain	Domain
PF18434	Kazal_3	791 → 838	Kazal-type serine protease inhibitor domain	Domain
PF00090	TSP_1	33 → 79	Thrombospondin type 1 domain	Domain
PF00090	TSP_1	501 → 549	Thrombospondin type 1 domain	Domain

Sequence

MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTN
EIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYG
THYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENAL
KAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK
LTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPY
TFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETT
ESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCN
EGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCS
GGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYE
CGPSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWG
KCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA
ETQ

Sequence length

843

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Complement and coagulation cascades	Terminal pathway of complement
Regulation of actin cytoskeleton	Regulation of Complement cascade
Prion disease
Coronavirus disease - COVID-19
Systemic lupus erythematosus

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
C7-related disorder	Likely pathogenic; Pathogenic	rs200365542, rs769923441, rs139491301	RCV003395502 RCV003395519 RCV003419845	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Complement component 7 deficiency	Likely pathogenic; Pathogenic	rs769984570, rs531103546, rs764871530, rs387906509, rs1467298230, rs1022194067, rs774370086, rs121964922, rs139491301, rs1579848888, rs779723422, rs770367814	RCV002308495 RCV000490515 RCV002259331 RCV000012885 RCV000012886 View all (7 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (7)
C7 and C6 deficiency, combined subtotal	Conflicting classifications of pathogenicity	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	33002439	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CARCINOMA	—	GWAS catalog	33002439	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Conflicting classifications of pathogenicity	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TERMINAL COMPONENT DEFICIENCY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
C8A	2	["Complement component deficiency","Terminal complement component deficiency"]	7	["Complement and coagulation cascades","Regulation of actin cytoskeleton","Prion disease","Coronavirus disease - COVID-19","Systemic lupus erythematosus","Regulation of Complement cascade","Terminal pathway of complement"]	5	["CTD (Complement component deficiency)","ClinVar (Complement component deficiency)","Disgenet (Complement component deficiency)","HPO (Complement component deficiency)","Disgenet (Terminal complement component deficiency)"]
C6	2	["Complement component deficiency","Terminal complement component deficiency"]	7	["Complement and coagulation cascades","Regulation of actin cytoskeleton","Prion disease","Coronavirus disease - COVID-19","Systemic lupus erythematosus","Regulation of Complement cascade","Terminal pathway of complement"]	6	["CTD (Complement component deficiency)","ClinVar (Complement component deficiency)","Disgenet (Complement component deficiency)","GWAS catalog (Complement component deficiency)","HPO (Complement component deficiency)","Disgenet (Terminal complement component deficiency)"]
C8B	2	["Complement component deficiency","Terminal complement component deficiency"]	7	["Complement and coagulation cascades","Regulation of actin cytoskeleton","Prion disease","Coronavirus disease - COVID-19","Systemic lupus erythematosus","Regulation of Complement cascade","Terminal pathway of complement"]	5	["CTD (Complement component deficiency)","ClinVar (Complement component deficiency)","Disgenet (Complement component deficiency)","HPO (Complement component deficiency)","Disgenet (Terminal complement component deficiency)"]
C5	2	["Complement component deficiency","Terminal complement component deficiency"]	7	["Complement and coagulation cascades","Regulation of actin cytoskeleton","Prion disease","Coronavirus disease - COVID-19","Systemic lupus erythematosus","Regulation of Complement cascade","Terminal pathway of complement"]	6	["CTD (Complement component deficiency)","ClinVar (Complement component deficiency)","Disgenet (Complement component deficiency)","GWAS catalog (Complement component deficiency)","HPO (Complement component deficiency)","Disgenet (Terminal complement component deficiency)"]
C9	2	["Complement component deficiency","Terminal complement component deficiency"]	7	["Complement and coagulation cascades","Regulation of actin cytoskeleton","Prion disease","Coronavirus disease - COVID-19","Systemic lupus erythematosus","Regulation of Complement cascade","Terminal pathway of complement"]	4	["ClinVar (Complement component deficiency)","Disgenet (Complement component deficiency)","HPO (Complement component deficiency)","Disgenet (Terminal complement component deficiency)"]

C7 (complement C7)

Bookmark This Gene