BAD (BCL2 associated agonist of cell death)

Gene

• Entrez ID: 572
• Gene name: BCL2 associated agonist of cell death
• Gene symbol: BAD
• Synonyms (NCBI Gene): BBC2, BCL2L8
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL (B-cell lymphoma-extra large)

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT038239	hsa-miR-330-5p	CLASH	23622248
MIRT814403	hsa-miR-1915	CLIP-seq
MIRT814404	hsa-miR-3124-5p	CLIP-seq
MIRT814405	hsa-miR-361-3p	CLIP-seq
MIRT814406	hsa-miR-4281	CLIP-seq
MIRT814407	hsa-miR-4283	CLIP-seq
MIRT814408	hsa-miR-4449	CLIP-seq
MIRT814409	hsa-miR-4685-5p	CLIP-seq
MIRT814410	hsa-miR-4761-3p	CLIP-seq
MIRT814411	hsa-miR-4783-3p	CLIP-seq
MIRT814403	hsa-miR-1915	CLIP-seq
MIRT814412	hsa-miR-3174	CLIP-seq
MIRT814413	hsa-miR-3177-3p	CLIP-seq
MIRT814405	hsa-miR-361-3p	CLIP-seq
MIRT814414	hsa-miR-3663-3p	CLIP-seq
MIRT814415	hsa-miR-4477a	CLIP-seq
MIRT814409	hsa-miR-4685-5p	CLIP-seq
MIRT814410	hsa-miR-4761-3p	CLIP-seq
MIRT814416	hsa-miR-921	CLIP-seq
MIRT2483221	hsa-miR-1203	CLIP-seq
MIRT2483222	hsa-miR-1275	CLIP-seq
MIRT2483223	hsa-miR-149	CLIP-seq
MIRT2483224	hsa-miR-1908	CLIP-seq
MIRT2483225	hsa-miR-3141	CLIP-seq
MIRT2483226	hsa-miR-3153	CLIP-seq
MIRT2483227	hsa-miR-3616-3p	CLIP-seq
MIRT2483228	hsa-miR-3940-3p	CLIP-seq
MIRT2483229	hsa-miR-4293	CLIP-seq
MIRT2483230	hsa-miR-4525	CLIP-seq
MIRT2483231	hsa-miR-4665-5p	CLIP-seq
MIRT2483232	hsa-miR-4721	CLIP-seq
MIRT2483233	hsa-miR-4723-5p	CLIP-seq
MIRT2483234	hsa-miR-490-3p	CLIP-seq
MIRT2483235	hsa-miR-544b	CLIP-seq
MIRT2483236	hsa-miR-566	CLIP-seq
MIRT2483237	hsa-miR-625	CLIP-seq
MIRT2483238	hsa-miR-637	CLIP-seq
MIRT2483239	hsa-miR-661	CLIP-seq
MIRT2483240	hsa-miR-663	CLIP-seq
MIRT2483241	hsa-miR-744	CLIP-seq
MIRT2483223	hsa-miR-149	CLIP-seq
MIRT2483234	hsa-miR-490-3p	CLIP-seq
MIRT2483236	hsa-miR-566	CLIP-seq
MIRT2483239	hsa-miR-661	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NR3C1	Activation	17496926
PPARG	Activation	14960510
RELA	Activation	20596645

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001836	Process	Release of cytochrome c from mitochondria	IBA
GO:0001836	Process	Release of cytochrome c from mitochondria	IEA
GO:0005515	Function	Protein binding	IPI	9388232, 9463381, 9973195, 10949025, 11526496, 15131699, 15694340, 16189514, 17446862, 17485524, 17979178, 19427857, 19427863, 19667065, 20005908, 20179209, 20603619, 20936779, 21081150, 21900206, 21988832, 22000515, 23397142, 24008843, 24255178, 25241761, 25416956, 26871637, 285144
GO:0005543	Function	Phospholipid binding	IMP	21081150
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	20700721
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	20700721
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006007	Process	Glucose catabolic process	IEA
GO:0006915	Process	Apoptotic process	IDA	19667065
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	7834748
GO:0008289	Function	Lipid binding	IDA	19667065
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0010508	Process	Positive regulation of autophagy	TAS	18309324
GO:0010918	Process	Positive regulation of mitochondrial membrane potential	IEA
GO:0010918	Process	Positive regulation of mitochondrial membrane potential	ISS
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IPI	17270021
GO:0019903	Function	Protein phosphatase binding	IBA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032024	Process	Positive regulation of insulin secretion	ISS
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9388232
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	17289999
GO:0043065	Process	Positive regulation of apoptotic process	NAS	14634621
GO:0043066	Process	Negative regulation of apoptotic process	IDA	18402937
GO:0044342	Process	Type B pancreatic cell proliferation	IEA
GO:0044342	Process	Type B pancreatic cell proliferation	ISS
GO:0045579	Process	Positive regulation of B cell differentiation	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0045862	Process	Positive regulation of proteolysis	IDA	18387192
GO:0046031	Process	ADP metabolic process	IEA
GO:0046031	Process	ADP metabolic process	ISS
GO:0046034	Process	ATP metabolic process	IEA
GO:0046034	Process	ATP metabolic process	ISS
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IBA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IMP	20700721
GO:0046931	Process	Pore complex assembly	IDA	19667065, 21081150
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IMP	19593445
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071316	Process	Cellular response to nicotine	IDA	18676776
GO:0071396	Process	Cellular response to lipid	IEA
GO:0071456	Process	Cellular response to hypoxia	IEP	20810912
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IMP	17289999
GO:0097138	Component	BAD-BCL-2 complex	IPI	9463381
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IBA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IMP	18852119
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IBA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IMP	18676776
GO:0140608	Function	Cysteine-type endopeptidase activator activity	IEA
GO:1902220	Process	Positive regulation of intrinsic apoptotic signaling pathway in response to osmotic stress	IEA
GO:2000078	Process	Positive regulation of type B pancreatic cell development	IEA
GO:2000078	Process	Positive regulation of type B pancreatic cell development	ISS

Other IDs

• MIM: 603167
• HGNC: 936
• e!Ensembl: ENSG00000002330

Protein

• UniProt ID: Q92934
• Protein name: Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-2-like protein 8) (Bcl2-L-8) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)
• Protein function: Promotes cell death. Successfully competes for the binding to Bcl-X(L), Bcl-2 and Bcl-W, thereby affecting the level of heterodimerization of these proteins with BAX. Can reverse the death repressor activity of Bcl-X(L), but not that of Bcl-2 (B
• PDB: 1G5J, 7Q16
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10514	Bcl-2_BAD	1 → 168	Pro-apoptotic Bcl-2 protein, BAD	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in a wide variety of tissues.
• Sequence:

  MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
  HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
  FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ

• Sequence length: 168

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRANSIENT ISCHEMIC ATTACK	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	15033904		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	30577817		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	24182354		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	16646081, 23566222, 28529565, 28599489, 29562785, 29956797, 30008912		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	16785131		★☆☆☆☆ Found in Text Mining only
Brain Stem Ischemia, Transient	Cerebral Ischemia	CTD_human_DG	12629175		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17670745, 19882362, 20691103, 22957045, 27485113, 28569785, 30635657, 31236965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	27485113	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17696955		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30008870		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21849418		★☆☆☆☆ Found in Text Mining only
Carotid Circulation Transient Ischemic Attack	Transient Ischemic Attack	CTD_human_DG	12629175		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30601084		★☆☆☆☆ Found in Text Mining only
Cleft palate and bilateral cleft lip	Cleft Palate And Bilateral Cleft Lip	BEFREE	31522540		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15033904, 17544220, 18593990		★☆☆☆☆ Found in Text Mining only
Color Blindness, Blue	Color blindness	BEFREE	19326440		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15183529, 17393317		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17393317		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12388275		★☆☆☆☆ Found in Text Mining only
Crescendo Transient Ischemic Attacks	Transient Ischemic Attack	CTD_human_DG	12629175		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29749466		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29366755		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29366755		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	25371288		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29126409		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22032837		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26590798, 29171006, 30841770		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21419810		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21419810		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12065618, 19158480, 19861406, 21419810		★☆☆☆☆ Found in Text Mining only
Glut1 Deficiency Syndrome	GLUT1 Deficiency Syndrome	BEFREE	26590798		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12388275		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	16949642		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	40539846	Inhibit	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	28687218		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	CTD_human_DG	12970779		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16869825, 27092880		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16807152, 20647330, 31129132		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	19326440		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30601084		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17670745, 19882362, 20691103, 22957045, 28569785, 30635657, 31236965		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22032837		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30008870		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21849418		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17542986, 19593445		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19593445, 28569785		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15033904, 16807152, 20596645, 21050670, 25653146, 27370604, 29079851, 31802101		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15033904, 25653146		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28446242		★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	27935851		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	28753606		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18246127		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29674508		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	26590798		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15033904, 19593445, 27965982, 28753606, 30635657, 7817950		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16690206		★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	28753606		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24713656		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29126409		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12087097		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21849418		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30309962		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	24614958		★☆☆☆☆ Found in Text Mining only
Posterior Circulation Transient Ischemic Attack	Transient Ischemic Attack	CTD_human_DG	12629175		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19593445, 28569785		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11839683, 16728406, 16847055		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17542986, 19593445		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19593445, 23633519		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	39217197	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	BEFREE	24036132		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19033458, 20596645		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18449891		★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	CTD_human_DG	12629175		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	CTD_human_DG	12629175		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Transient Ischemic Attack, Anterior Circulation	Transient Ischemic Attack	CTD_human_DG	12629175		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack, Vertebrobasilar Circulation	Transient Ischemic Attack	CTD_human_DG	12629175		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27367565, 31767884		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	8594511		★☆☆☆☆ Found in Text Mining only